Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GAT6

Protein Details
Accession A0A0K6GAT6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
155-174PPPAPAKRGRGRPRTTNRETBasic
NLS Segment(s)
PositionSequence
152-168PPPPPPAPAKRGRGRPR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
IPR000608  UBQ-conjugat_E2  
IPR016135  UBQ-conjugating_enzyme/RWD  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
PS50127  UBC_2  
CDD cd00195  UBCc  
Amino Acid Sequences MASTTGRPTGMTLKRIQKEMKDLQSEDMGGITLAPSDHSLFEWTGTLPGPEGSVYEGGEFHVEITLPPDYPIYHMNINDQGGICLDILKNAWSPALSLYKVMLSLSSLLTDPNPSDPLVPAIANEYTRRRKVHDSTARRWVQLHAQPVKAQPPPPPPAPAKRGRGRPRTTNRETIMVPDDETTSTSTSATGAKRKRGDDDREDRSKRQSTGGAGGSGSGSGNVIVIDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.58
4 0.54
5 0.57
6 0.61
7 0.62
8 0.59
9 0.56
10 0.53
11 0.5
12 0.45
13 0.36
14 0.27
15 0.18
16 0.12
17 0.1
18 0.07
19 0.05
20 0.05
21 0.05
22 0.07
23 0.08
24 0.08
25 0.09
26 0.11
27 0.11
28 0.12
29 0.12
30 0.11
31 0.11
32 0.11
33 0.1
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.06
49 0.06
50 0.05
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.11
58 0.12
59 0.13
60 0.15
61 0.15
62 0.17
63 0.19
64 0.19
65 0.19
66 0.17
67 0.14
68 0.12
69 0.12
70 0.1
71 0.08
72 0.07
73 0.06
74 0.07
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.07
81 0.09
82 0.12
83 0.11
84 0.1
85 0.11
86 0.11
87 0.11
88 0.1
89 0.08
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.06
99 0.07
100 0.08
101 0.07
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.07
108 0.08
109 0.09
110 0.09
111 0.11
112 0.16
113 0.21
114 0.25
115 0.27
116 0.29
117 0.35
118 0.39
119 0.48
120 0.52
121 0.55
122 0.56
123 0.65
124 0.63
125 0.56
126 0.53
127 0.43
128 0.41
129 0.37
130 0.41
131 0.35
132 0.34
133 0.36
134 0.37
135 0.4
136 0.35
137 0.33
138 0.31
139 0.34
140 0.37
141 0.37
142 0.41
143 0.4
144 0.45
145 0.5
146 0.52
147 0.53
148 0.56
149 0.64
150 0.69
151 0.74
152 0.73
153 0.77
154 0.79
155 0.8
156 0.79
157 0.77
158 0.7
159 0.64
160 0.58
161 0.51
162 0.45
163 0.36
164 0.3
165 0.22
166 0.21
167 0.17
168 0.18
169 0.15
170 0.12
171 0.12
172 0.11
173 0.1
174 0.1
175 0.14
176 0.17
177 0.24
178 0.28
179 0.36
180 0.42
181 0.45
182 0.52
183 0.57
184 0.62
185 0.64
186 0.68
187 0.68
188 0.73
189 0.75
190 0.7
191 0.7
192 0.68
193 0.59
194 0.55
195 0.51
196 0.45
197 0.48
198 0.47
199 0.39
200 0.32
201 0.31
202 0.26
203 0.21
204 0.17
205 0.1
206 0.07
207 0.06
208 0.06