Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38801

Protein Details
Accession P38801   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
157-184DSTDHIRKASSKKSKRLDKVGKKKGGKKBasic
NLS Segment(s)
PositionSequence
163-184RKASSKKSKRLDKVGKKKGGKK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0000178  C:exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003690  F:double-stranded DNA binding  
GO:0003725  F:double-stranded RNA binding  
GO:0030234  F:enzyme regulator activity  
GO:0044877  F:protein-containing complex binding  
GO:0003723  F:RNA binding  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0071028  P:nuclear mRNA surveillance  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071051  P:polyadenylation-dependent snoRNA 3'-end processing  
GO:0000973  P:post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery  
GO:0010468  P:regulation of gene expression  
GO:0034475  P:U4 snRNA 3'-end processing  
GO:0034476  P:U5 snRNA 3'-end processing  
KEGG sce:YHR081W  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELINRYAYVLSSLMFANMKVLGVKDMSPILGELKRVKSYMDKAKQYDNRITKSNEKSQAEQEKAKNIISNVLDGNKNQFEPSISRSNFQGKHTKFENDELAESTTTKIIDSTDHIRKASSKKSKRLDKVGKKKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.47
4 0.47
5 0.43
6 0.42
7 0.39
8 0.41
9 0.37
10 0.31
11 0.27
12 0.26
13 0.23
14 0.23
15 0.29
16 0.25
17 0.25
18 0.29
19 0.32
20 0.31
21 0.29
22 0.26
23 0.18
24 0.17
25 0.17
26 0.13
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.09
33 0.1
34 0.14
35 0.2
36 0.2
37 0.22
38 0.22
39 0.22
40 0.22
41 0.2
42 0.17
43 0.11
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.09
65 0.1
66 0.12
67 0.15
68 0.16
69 0.16
70 0.17
71 0.18
72 0.24
73 0.32
74 0.36
75 0.38
76 0.38
77 0.47
78 0.51
79 0.51
80 0.53
81 0.48
82 0.43
83 0.43
84 0.45
85 0.45
86 0.46
87 0.49
88 0.49
89 0.46
90 0.45
91 0.49
92 0.54
93 0.49
94 0.49
95 0.43
96 0.4
97 0.4
98 0.38
99 0.32
100 0.24
101 0.26
102 0.21
103 0.21
104 0.16
105 0.18
106 0.18
107 0.16
108 0.21
109 0.17
110 0.17
111 0.15
112 0.15
113 0.14
114 0.16
115 0.21
116 0.26
117 0.25
118 0.26
119 0.28
120 0.36
121 0.38
122 0.39
123 0.44
124 0.36
125 0.42
126 0.44
127 0.46
128 0.41
129 0.42
130 0.44
131 0.36
132 0.35
133 0.31
134 0.29
135 0.25
136 0.23
137 0.2
138 0.15
139 0.13
140 0.12
141 0.1
142 0.09
143 0.1
144 0.14
145 0.21
146 0.27
147 0.31
148 0.31
149 0.32
150 0.38
151 0.43
152 0.49
153 0.53
154 0.54
155 0.61
156 0.71
157 0.8
158 0.83
159 0.87
160 0.88
161 0.88
162 0.9
163 0.91
164 0.91