Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FR85

Protein Details
Accession A0A0K6FR85    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRGGGKRERRSQQTKRRKEGVGABasic
156-182ITTPNTPVKPRPRPKVRLPPGTRDRPEHydrophilic
NLS Segment(s)
PositionSequence
5-18GKRERRSQQTKRRK
103-121AKRKEAEQGKPMEKGKGKG
151-181RVKKAITTPNTPVKPRPRPKVRLPPGTRDRP
190-197KGYRRKAN
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRGGGKRERRSQQTKRRKEGVGAGTGADTGADIDVDADASAEARTDTDNEAKTEQELGEVRDECEGDKDKPKAKRGVVSEDKGSDSEEDGEDEVKMATRGPTAKRKEAEQGKPMEKGKGKGTRAPVNDVSEESDGGEAGESESEGGPALKRVKKAITTPNTPVKPRPRPKVRLPPGTRDRPEESEGDSWKGYRRKANKVGGGNEGNTGGKRKSCVTTDHEPTWRKRTKSAAAAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.81
5 0.76
6 0.75
7 0.7
8 0.65
9 0.55
10 0.46
11 0.38
12 0.34
13 0.28
14 0.18
15 0.11
16 0.06
17 0.05
18 0.04
19 0.03
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.07
33 0.1
34 0.15
35 0.17
36 0.19
37 0.2
38 0.19
39 0.19
40 0.2
41 0.17
42 0.16
43 0.15
44 0.15
45 0.19
46 0.19
47 0.19
48 0.18
49 0.19
50 0.15
51 0.18
52 0.2
53 0.18
54 0.25
55 0.29
56 0.34
57 0.41
58 0.48
59 0.51
60 0.51
61 0.54
62 0.51
63 0.57
64 0.57
65 0.54
66 0.5
67 0.43
68 0.41
69 0.34
70 0.31
71 0.21
72 0.15
73 0.13
74 0.11
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.07
86 0.11
87 0.15
88 0.24
89 0.28
90 0.34
91 0.35
92 0.36
93 0.43
94 0.48
95 0.5
96 0.47
97 0.49
98 0.45
99 0.48
100 0.47
101 0.44
102 0.37
103 0.34
104 0.35
105 0.37
106 0.36
107 0.36
108 0.41
109 0.42
110 0.41
111 0.44
112 0.4
113 0.34
114 0.33
115 0.29
116 0.26
117 0.2
118 0.18
119 0.13
120 0.1
121 0.08
122 0.07
123 0.06
124 0.04
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.08
135 0.14
136 0.17
137 0.18
138 0.2
139 0.24
140 0.27
141 0.33
142 0.39
143 0.4
144 0.43
145 0.48
146 0.55
147 0.55
148 0.54
149 0.55
150 0.56
151 0.6
152 0.63
153 0.68
154 0.69
155 0.73
156 0.81
157 0.85
158 0.84
159 0.85
160 0.81
161 0.8
162 0.79
163 0.82
164 0.74
165 0.69
166 0.65
167 0.59
168 0.56
169 0.47
170 0.43
171 0.38
172 0.37
173 0.34
174 0.29
175 0.25
176 0.3
177 0.33
178 0.34
179 0.37
180 0.43
181 0.5
182 0.59
183 0.67
184 0.68
185 0.7
186 0.7
187 0.68
188 0.64
189 0.54
190 0.46
191 0.38
192 0.31
193 0.25
194 0.25
195 0.2
196 0.19
197 0.21
198 0.23
199 0.27
200 0.29
201 0.34
202 0.37
203 0.44
204 0.5
205 0.54
206 0.58
207 0.6
208 0.63
209 0.67
210 0.69
211 0.62
212 0.62
213 0.64
214 0.65
215 0.68