Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K6FQF5

Protein Details
Accession A0A0K6FQF5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68STPAQGKVRTVRRKDRPASRGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 6, extr 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MWASGVMCLVPVVKTWNVWAFDSRRPASAREDQSVFWKADVAEDISSTPAQGKVRTVRRKDRPASRGTFVAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.19
4 0.21
5 0.22
6 0.26
7 0.25
8 0.3
9 0.37
10 0.35
11 0.34
12 0.33
13 0.34
14 0.35
15 0.4
16 0.39
17 0.35
18 0.35
19 0.32
20 0.34
21 0.35
22 0.29
23 0.2
24 0.17
25 0.14
26 0.13
27 0.13
28 0.11
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.08
35 0.08
36 0.1
37 0.11
38 0.12
39 0.16
40 0.24
41 0.34
42 0.44
43 0.51
44 0.58
45 0.67
46 0.77
47 0.81
48 0.83
49 0.8
50 0.8
51 0.78
52 0.72
53 0.64