Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8TGU7

Protein Details
Accession Q8TGU7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAITPDKQKKEQQHQPQNGPLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, mito 5, plas 4, E.R. 4, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
KEGG sce:YBR126W-A  -  
Amino Acid Sequences MAITPDKQKKEQQHQPQNGPLDYAHICKCIAMFFVVAGVVLMFFETGLDPEQKEQIKRLHQLDGIPHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.8
4 0.75
5 0.65
6 0.55
7 0.44
8 0.37
9 0.3
10 0.27
11 0.21
12 0.17
13 0.16
14 0.15
15 0.15
16 0.11
17 0.1
18 0.08
19 0.07
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.04
34 0.05
35 0.07
36 0.07
37 0.09
38 0.15
39 0.18
40 0.19
41 0.24
42 0.3
43 0.36
44 0.43
45 0.45
46 0.45
47 0.44
48 0.46