Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53183

Protein Details
Accession P53183   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
306-327FLTKNCCKCDNRKTKNLLGFQFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, E.R. 4, cyto 3, vacu 3, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001509  Epimerase_deHydtase  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004029  F:aldehyde dehydrogenase (NAD+) activity  
GO:0004090  F:carbonyl reductase (NADPH) activity  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
GO:0016616  F:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor  
GO:0006725  P:cellular aromatic compound metabolic process  
GO:0042180  P:cellular ketone metabolic process  
GO:1901426  P:response to furfural  
KEGG sce:YGL039W  -  
Pfam View protein in Pfam  
PF01370  Epimerase  
CDD cd05227  AR_SDR_e  
Amino Acid Sequences MTTEKTVVFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKFKSNPNLSMEIVEDIAAPNAFDKVFQKHGKEIKVVLHIASPVHFNTTDFEKDLLIPAVNGTKSILEAIKNYAADTVEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKTAWDFLEENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLVSYKLGDNFYNYSGPFIDVRDVSKAHLLAFEKPECAGQRLFLCEDMFCSQEALDILNEEFPQLKGKIATGEPGSGSTFLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQLLEVQSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.08
14 0.08
15 0.09
16 0.11
17 0.1
18 0.12
19 0.14
20 0.21
21 0.22
22 0.29
23 0.36
24 0.4
25 0.41
26 0.45
27 0.43
28 0.41
29 0.46
30 0.46
31 0.42
32 0.45
33 0.46
34 0.5
35 0.56
36 0.57
37 0.6
38 0.6
39 0.62
40 0.6
41 0.61
42 0.54
43 0.47
44 0.41
45 0.33
46 0.26
47 0.2
48 0.13
49 0.1
50 0.1
51 0.08
52 0.07
53 0.06
54 0.07
55 0.07
56 0.08
57 0.1
58 0.14
59 0.22
60 0.27
61 0.29
62 0.36
63 0.43
64 0.45
65 0.45
66 0.44
67 0.4
68 0.41
69 0.39
70 0.32
71 0.27
72 0.24
73 0.22
74 0.2
75 0.16
76 0.11
77 0.13
78 0.13
79 0.12
80 0.13
81 0.17
82 0.18
83 0.17
84 0.18
85 0.15
86 0.16
87 0.17
88 0.16
89 0.11
90 0.1
91 0.09
92 0.12
93 0.11
94 0.11
95 0.1
96 0.09
97 0.09
98 0.11
99 0.11
100 0.08
101 0.1
102 0.12
103 0.15
104 0.14
105 0.14
106 0.14
107 0.13
108 0.13
109 0.13
110 0.12
111 0.1
112 0.1
113 0.1
114 0.09
115 0.08
116 0.08
117 0.07
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.07
133 0.08
134 0.08
135 0.08
136 0.09
137 0.1
138 0.11
139 0.13
140 0.14
141 0.14
142 0.14
143 0.14
144 0.14
145 0.15
146 0.23
147 0.21
148 0.2
149 0.23
150 0.23
151 0.22
152 0.22
153 0.2
154 0.11
155 0.11
156 0.12
157 0.08
158 0.09
159 0.09
160 0.11
161 0.14
162 0.15
163 0.19
164 0.22
165 0.23
166 0.28
167 0.32
168 0.3
169 0.29
170 0.27
171 0.23
172 0.29
173 0.27
174 0.22
175 0.17
176 0.17
177 0.16
178 0.16
179 0.16
180 0.06
181 0.07
182 0.12
183 0.12
184 0.17
185 0.17
186 0.18
187 0.18
188 0.18
189 0.18
190 0.12
191 0.14
192 0.09
193 0.11
194 0.09
195 0.1
196 0.1
197 0.1
198 0.11
199 0.09
200 0.11
201 0.09
202 0.09
203 0.09
204 0.09
205 0.09
206 0.08
207 0.08
208 0.08
209 0.07
210 0.07
211 0.07
212 0.07
213 0.06
214 0.07
215 0.06
216 0.05
217 0.05
218 0.06
219 0.07
220 0.09
221 0.09
222 0.1
223 0.12
224 0.14
225 0.16
226 0.15
227 0.15
228 0.14
229 0.15
230 0.13
231 0.12
232 0.13
233 0.12
234 0.13
235 0.15
236 0.15
237 0.15
238 0.17
239 0.17
240 0.15
241 0.18
242 0.18
243 0.2
244 0.25
245 0.25
246 0.23
247 0.22
248 0.26
249 0.23
250 0.24
251 0.2
252 0.18
253 0.19
254 0.22
255 0.23
256 0.21
257 0.2
258 0.17
259 0.2
260 0.19
261 0.17
262 0.14
263 0.13
264 0.11
265 0.12
266 0.13
267 0.11
268 0.09
269 0.09
270 0.1
271 0.11
272 0.11
273 0.1
274 0.1
275 0.1
276 0.14
277 0.13
278 0.15
279 0.14
280 0.15
281 0.19
282 0.19
283 0.23
284 0.2
285 0.21
286 0.19
287 0.2
288 0.2
289 0.16
290 0.16
291 0.15
292 0.15
293 0.16
294 0.23
295 0.27
296 0.31
297 0.37
298 0.44
299 0.46
300 0.55
301 0.64
302 0.68
303 0.72
304 0.77
305 0.79
306 0.8
307 0.83
308 0.81
309 0.76
310 0.74
311 0.71
312 0.68
313 0.69
314 0.62
315 0.56
316 0.48
317 0.43
318 0.38
319 0.35
320 0.3
321 0.26
322 0.29
323 0.27
324 0.3
325 0.29
326 0.24
327 0.22
328 0.21