Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FK58

Protein Details
Accession A0A0K6FK58    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-65LGYPKKPTAVNQPKPPKLRKSPTPTPKKPKKEVYFPDLAHydrophilic
308-329GSTLTAKARKPRPKKPIGLLVVHydrophilic
NLS Segment(s)
PositionSequence
38-57QPKPPKLRKSPTPTPKKPKK
314-323KARKPRPKKP
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006281  P:DNA repair  
Amino Acid Sequences MASRVIRSTTHTRSLVTGTPVVAANWLGYPKKPTAVNQPKPPKLRKSPTPTPKKPKKEVYFPDLAEPPPFDGPPYNPTFIPAKLTFSLEQAKNHLIKADARFEQLVTSTQCQLFEQLEPIDPFRALVASVIGHNTIWTTAMPIRHRLLRLFDRSLPEEVPLTHEQELSYPFPSPSQVASVDNEILTTTGMNENQAEQVLEIAKRFEDGRLSTEKLINASDKQVEEILTGAIGKEKASIFAITTLRRPDILPVGSPGAQRGLLNWVLSSHEPESYPLYIRRGKLSKPYKDLENSEVEVPEPVEDTSAPGSTLTAKARKPRPKKPIGLLVVPTSPVRLPKGVTLDTLKDRASGEQTTGRYLLPNEMEALTASWKPYRSLGVFYMWALVGTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.39
4 0.34
5 0.26
6 0.27
7 0.26
8 0.23
9 0.2
10 0.15
11 0.12
12 0.12
13 0.15
14 0.15
15 0.16
16 0.21
17 0.22
18 0.27
19 0.29
20 0.32
21 0.39
22 0.49
23 0.57
24 0.63
25 0.71
26 0.75
27 0.81
28 0.85
29 0.84
30 0.83
31 0.84
32 0.83
33 0.82
34 0.85
35 0.86
36 0.89
37 0.9
38 0.9
39 0.91
40 0.91
41 0.91
42 0.91
43 0.89
44 0.88
45 0.86
46 0.82
47 0.8
48 0.71
49 0.67
50 0.59
51 0.51
52 0.42
53 0.35
54 0.3
55 0.24
56 0.23
57 0.18
58 0.18
59 0.2
60 0.25
61 0.29
62 0.28
63 0.26
64 0.28
65 0.3
66 0.27
67 0.31
68 0.25
69 0.25
70 0.24
71 0.28
72 0.26
73 0.27
74 0.34
75 0.3
76 0.31
77 0.3
78 0.34
79 0.32
80 0.32
81 0.3
82 0.23
83 0.26
84 0.29
85 0.32
86 0.28
87 0.28
88 0.28
89 0.27
90 0.26
91 0.21
92 0.21
93 0.17
94 0.18
95 0.19
96 0.2
97 0.2
98 0.2
99 0.21
100 0.18
101 0.16
102 0.16
103 0.14
104 0.16
105 0.16
106 0.17
107 0.16
108 0.14
109 0.14
110 0.11
111 0.1
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.05
123 0.06
124 0.05
125 0.07
126 0.09
127 0.14
128 0.16
129 0.2
130 0.22
131 0.25
132 0.27
133 0.26
134 0.3
135 0.32
136 0.36
137 0.36
138 0.37
139 0.37
140 0.38
141 0.39
142 0.32
143 0.26
144 0.21
145 0.18
146 0.2
147 0.18
148 0.18
149 0.17
150 0.17
151 0.16
152 0.16
153 0.19
154 0.15
155 0.14
156 0.12
157 0.12
158 0.12
159 0.13
160 0.12
161 0.1
162 0.1
163 0.11
164 0.11
165 0.12
166 0.13
167 0.13
168 0.12
169 0.11
170 0.09
171 0.07
172 0.06
173 0.05
174 0.04
175 0.05
176 0.06
177 0.06
178 0.06
179 0.07
180 0.07
181 0.07
182 0.07
183 0.05
184 0.06
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.07
193 0.09
194 0.09
195 0.12
196 0.16
197 0.18
198 0.19
199 0.2
200 0.2
201 0.18
202 0.19
203 0.17
204 0.14
205 0.14
206 0.15
207 0.13
208 0.13
209 0.13
210 0.12
211 0.11
212 0.1
213 0.08
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.07
221 0.07
222 0.08
223 0.09
224 0.1
225 0.09
226 0.14
227 0.16
228 0.15
229 0.18
230 0.19
231 0.18
232 0.19
233 0.19
234 0.16
235 0.19
236 0.19
237 0.17
238 0.17
239 0.19
240 0.2
241 0.2
242 0.18
243 0.14
244 0.14
245 0.13
246 0.12
247 0.13
248 0.13
249 0.13
250 0.12
251 0.11
252 0.13
253 0.14
254 0.16
255 0.13
256 0.13
257 0.13
258 0.14
259 0.17
260 0.16
261 0.19
262 0.18
263 0.23
264 0.26
265 0.27
266 0.33
267 0.34
268 0.35
269 0.43
270 0.5
271 0.53
272 0.55
273 0.57
274 0.56
275 0.58
276 0.59
277 0.52
278 0.48
279 0.41
280 0.36
281 0.33
282 0.27
283 0.22
284 0.18
285 0.14
286 0.1
287 0.08
288 0.08
289 0.07
290 0.09
291 0.1
292 0.1
293 0.1
294 0.09
295 0.09
296 0.1
297 0.14
298 0.17
299 0.22
300 0.25
301 0.34
302 0.44
303 0.54
304 0.62
305 0.68
306 0.74
307 0.79
308 0.84
309 0.83
310 0.84
311 0.79
312 0.75
313 0.68
314 0.6
315 0.51
316 0.44
317 0.36
318 0.27
319 0.23
320 0.2
321 0.21
322 0.19
323 0.2
324 0.23
325 0.3
326 0.29
327 0.31
328 0.32
329 0.34
330 0.37
331 0.38
332 0.33
333 0.29
334 0.29
335 0.28
336 0.29
337 0.25
338 0.24
339 0.28
340 0.29
341 0.3
342 0.3
343 0.27
344 0.25
345 0.25
346 0.27
347 0.23
348 0.22
349 0.21
350 0.2
351 0.2
352 0.18
353 0.18
354 0.15
355 0.15
356 0.16
357 0.18
358 0.19
359 0.2
360 0.22
361 0.28
362 0.27
363 0.31
364 0.31
365 0.32
366 0.32
367 0.31
368 0.31
369 0.23
370 0.21