Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40858

Protein Details
Accession P40858    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
122-152GKTKRAFQTREVTKRRNRRVRHAKSKGDLTIHydrophilic
NLS Segment(s)
PositionSequence
134-147TKRRNRRVRHAKSK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YJL096W  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MLQLKFIWPVARITPIYRPFTSHPFRNLATSSSISSTKAKTTKTDTTPLKLSNELYAIFKIHNRPYLVTEGDRVILPFKLKQAEVGDILNMTDVTTLGSRNYKLVGHPINTSLYTLKATVVGKTKRAFQTREVTKRRNRRVRHAKSKGDLTILRISELSMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.43
4 0.4
5 0.43
6 0.41
7 0.49
8 0.53
9 0.5
10 0.48
11 0.47
12 0.47
13 0.46
14 0.43
15 0.36
16 0.33
17 0.29
18 0.26
19 0.23
20 0.23
21 0.21
22 0.23
23 0.22
24 0.24
25 0.27
26 0.27
27 0.28
28 0.35
29 0.41
30 0.42
31 0.5
32 0.47
33 0.47
34 0.5
35 0.48
36 0.43
37 0.37
38 0.33
39 0.26
40 0.24
41 0.2
42 0.17
43 0.15
44 0.14
45 0.12
46 0.14
47 0.17
48 0.19
49 0.23
50 0.22
51 0.23
52 0.25
53 0.27
54 0.27
55 0.22
56 0.21
57 0.16
58 0.16
59 0.15
60 0.12
61 0.1
62 0.09
63 0.09
64 0.09
65 0.1
66 0.11
67 0.11
68 0.14
69 0.14
70 0.15
71 0.15
72 0.14
73 0.12
74 0.1
75 0.1
76 0.08
77 0.06
78 0.05
79 0.03
80 0.03
81 0.04
82 0.05
83 0.05
84 0.06
85 0.08
86 0.09
87 0.09
88 0.11
89 0.1
90 0.11
91 0.18
92 0.2
93 0.2
94 0.21
95 0.22
96 0.23
97 0.23
98 0.23
99 0.16
100 0.14
101 0.13
102 0.12
103 0.11
104 0.13
105 0.13
106 0.15
107 0.23
108 0.24
109 0.29
110 0.3
111 0.38
112 0.41
113 0.47
114 0.46
115 0.44
116 0.52
117 0.57
118 0.67
119 0.67
120 0.69
121 0.72
122 0.81
123 0.85
124 0.85
125 0.82
126 0.83
127 0.86
128 0.88
129 0.9
130 0.89
131 0.88
132 0.85
133 0.85
134 0.77
135 0.72
136 0.63
137 0.57
138 0.54
139 0.45
140 0.39
141 0.32