Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40573

Protein Details
Accession P40573    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
116-139TEASQRFRIRKKQKNFENMNKLQNHydrophilic
NLS Segment(s)
PositionSequence
110-127ERRRKNTEASQRFRIRKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0089713  C:Cbf1-Met4-Met28 complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0061629  F:RNA polymerase II-specific DNA-binding transcription factor binding  
GO:0019344  P:cysteine biosynthetic process  
GO:0009086  P:methionine biosynthetic process  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:2000679  P:positive regulation of transcription regulatory region DNA binding  
GO:0031335  P:regulation of sulfur amino acid metabolic process  
GO:0042762  P:regulation of sulfur metabolic process  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG sce:YIR017C  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MSAKQGWEKKSTNIDIASRKGMNVNNLSEHLQNLISSDSELGSRLLSLLLVSSGNAEELISMINNGQDVSQFKKLREPRKGKVAATTAVVVKEEEAPVSTSNELDKIKQERRRKNTEASQRFRIRKKQKNFENMNKLQNLNTQINKLRDRIEQLNKENEFWKAKLNDINEIKSLKLLNDIKRRNMGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.5
4 0.49
5 0.4
6 0.37
7 0.37
8 0.36
9 0.36
10 0.35
11 0.34
12 0.31
13 0.32
14 0.34
15 0.3
16 0.28
17 0.22
18 0.18
19 0.15
20 0.13
21 0.12
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.09
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.04
54 0.06
55 0.08
56 0.12
57 0.2
58 0.22
59 0.22
60 0.31
61 0.38
62 0.45
63 0.54
64 0.58
65 0.54
66 0.63
67 0.67
68 0.59
69 0.57
70 0.51
71 0.42
72 0.35
73 0.32
74 0.22
75 0.18
76 0.17
77 0.11
78 0.09
79 0.09
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.08
87 0.07
88 0.08
89 0.11
90 0.1
91 0.1
92 0.14
93 0.2
94 0.27
95 0.35
96 0.45
97 0.52
98 0.6
99 0.68
100 0.68
101 0.7
102 0.71
103 0.74
104 0.75
105 0.71
106 0.73
107 0.72
108 0.74
109 0.72
110 0.74
111 0.73
112 0.73
113 0.78
114 0.79
115 0.79
116 0.83
117 0.86
118 0.86
119 0.85
120 0.81
121 0.77
122 0.7
123 0.62
124 0.53
125 0.48
126 0.43
127 0.38
128 0.35
129 0.33
130 0.36
131 0.42
132 0.43
133 0.41
134 0.38
135 0.36
136 0.41
137 0.45
138 0.49
139 0.51
140 0.53
141 0.6
142 0.58
143 0.57
144 0.52
145 0.49
146 0.43
147 0.35
148 0.38
149 0.31
150 0.34
151 0.38
152 0.38
153 0.42
154 0.42
155 0.44
156 0.4
157 0.39
158 0.35
159 0.32
160 0.31
161 0.22
162 0.27
163 0.31
164 0.36
165 0.46
166 0.52
167 0.55