Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6FKI4

Protein Details
Accession A0A0K6FKI4   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
307-336SKESGSKTSNRNNKSRKRRRVQDRAESASPHydrophilic
NLS Segment(s)
PositionSequence
315-326SNRNNKSRKRRR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MDLSIPQATPEPAEDLERGRNTNASDRDLTYRPPAPGSNTSFSAHSNLSLTSIPAKAKTALAKASPEGQLCVITRRKSHVECAHILRRTTKSDELKRLEFSWGCKPGKLDLDDAENMIWLSPELHRCFDSRHWALVPSLELLEDIQKKVNKTFVHRVHTHFKKKYPSGRREYSYVQLETDEEPIPRFDATVPGGATLHQSPFTTLPPILSHIHPYFVICNVAQKDIKLHPEPEPESEPESDEELPGYATLQGDEGKSVLERIRRCRTIYQLWMAIPHAAHLDHNNSLPTQSSRSGASSGGGSRQSGSKESGSKTSNRNNKSRKRRRVQDRAESASPLEDRWNIDGGNQCGDVAVPCWLKVENWLNDVEVVSGIATKPMEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.28
4 0.3
5 0.31
6 0.29
7 0.31
8 0.31
9 0.39
10 0.39
11 0.37
12 0.37
13 0.38
14 0.42
15 0.41
16 0.41
17 0.39
18 0.4
19 0.36
20 0.36
21 0.36
22 0.36
23 0.43
24 0.46
25 0.44
26 0.42
27 0.41
28 0.39
29 0.38
30 0.35
31 0.27
32 0.22
33 0.19
34 0.16
35 0.17
36 0.16
37 0.16
38 0.15
39 0.17
40 0.17
41 0.18
42 0.2
43 0.19
44 0.22
45 0.26
46 0.27
47 0.28
48 0.29
49 0.3
50 0.29
51 0.33
52 0.32
53 0.29
54 0.26
55 0.22
56 0.23
57 0.21
58 0.27
59 0.28
60 0.29
61 0.3
62 0.35
63 0.41
64 0.41
65 0.49
66 0.49
67 0.49
68 0.51
69 0.57
70 0.59
71 0.56
72 0.55
73 0.51
74 0.48
75 0.46
76 0.46
77 0.47
78 0.49
79 0.53
80 0.61
81 0.61
82 0.6
83 0.58
84 0.55
85 0.52
86 0.44
87 0.39
88 0.39
89 0.42
90 0.39
91 0.38
92 0.38
93 0.37
94 0.41
95 0.39
96 0.32
97 0.25
98 0.29
99 0.28
100 0.27
101 0.22
102 0.16
103 0.14
104 0.11
105 0.1
106 0.05
107 0.06
108 0.08
109 0.14
110 0.16
111 0.18
112 0.19
113 0.2
114 0.23
115 0.26
116 0.33
117 0.29
118 0.3
119 0.29
120 0.29
121 0.29
122 0.26
123 0.23
124 0.15
125 0.13
126 0.1
127 0.09
128 0.08
129 0.13
130 0.13
131 0.12
132 0.16
133 0.18
134 0.19
135 0.21
136 0.26
137 0.23
138 0.29
139 0.38
140 0.41
141 0.46
142 0.48
143 0.52
144 0.56
145 0.63
146 0.66
147 0.6
148 0.58
149 0.6
150 0.64
151 0.69
152 0.69
153 0.69
154 0.68
155 0.7
156 0.67
157 0.63
158 0.59
159 0.55
160 0.49
161 0.4
162 0.32
163 0.26
164 0.24
165 0.21
166 0.2
167 0.15
168 0.11
169 0.11
170 0.11
171 0.11
172 0.09
173 0.09
174 0.06
175 0.08
176 0.09
177 0.11
178 0.11
179 0.1
180 0.1
181 0.1
182 0.11
183 0.1
184 0.09
185 0.08
186 0.08
187 0.09
188 0.1
189 0.11
190 0.11
191 0.1
192 0.1
193 0.1
194 0.13
195 0.14
196 0.14
197 0.18
198 0.16
199 0.17
200 0.16
201 0.16
202 0.14
203 0.13
204 0.14
205 0.09
206 0.13
207 0.13
208 0.16
209 0.16
210 0.15
211 0.19
212 0.2
213 0.26
214 0.23
215 0.24
216 0.25
217 0.31
218 0.33
219 0.32
220 0.32
221 0.29
222 0.29
223 0.27
224 0.25
225 0.19
226 0.2
227 0.17
228 0.14
229 0.12
230 0.1
231 0.09
232 0.08
233 0.07
234 0.06
235 0.05
236 0.05
237 0.06
238 0.07
239 0.07
240 0.07
241 0.07
242 0.06
243 0.06
244 0.08
245 0.1
246 0.14
247 0.19
248 0.27
249 0.36
250 0.39
251 0.42
252 0.45
253 0.5
254 0.52
255 0.54
256 0.51
257 0.46
258 0.43
259 0.41
260 0.37
261 0.31
262 0.23
263 0.18
264 0.14
265 0.1
266 0.11
267 0.12
268 0.14
269 0.14
270 0.16
271 0.16
272 0.15
273 0.15
274 0.16
275 0.16
276 0.17
277 0.17
278 0.17
279 0.18
280 0.19
281 0.2
282 0.18
283 0.17
284 0.15
285 0.15
286 0.17
287 0.17
288 0.15
289 0.15
290 0.18
291 0.19
292 0.19
293 0.21
294 0.22
295 0.26
296 0.29
297 0.34
298 0.34
299 0.38
300 0.44
301 0.5
302 0.55
303 0.56
304 0.64
305 0.68
306 0.75
307 0.81
308 0.85
309 0.86
310 0.88
311 0.92
312 0.93
313 0.94
314 0.94
315 0.93
316 0.92
317 0.88
318 0.8
319 0.71
320 0.6
321 0.54
322 0.44
323 0.34
324 0.28
325 0.22
326 0.23
327 0.23
328 0.25
329 0.2
330 0.23
331 0.29
332 0.27
333 0.28
334 0.26
335 0.23
336 0.2
337 0.21
338 0.18
339 0.12
340 0.17
341 0.14
342 0.14
343 0.16
344 0.16
345 0.16
346 0.24
347 0.32
348 0.3
349 0.31
350 0.32
351 0.32
352 0.32
353 0.32
354 0.24
355 0.15
356 0.11
357 0.09
358 0.09
359 0.08
360 0.1