Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6GF61

Protein Details
Accession A0A0K6GF61    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRVHKAQRDVHRASRBasic
73-98AALRSHWKGKVHKRRCKQLKEPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRVHKAQRDVHRASRTRARTRDLDQIQLHDLDPAVRAKLEAQPIDIEKPGLAQHYCVECAKYFETDAALRSHWKGKVHKRRCKQLKEPAYTIEEAERAGGLGREVRKRPNTDSDTQPAQTEMVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.79
4 0.78
5 0.72
6 0.69
7 0.69
8 0.68
9 0.68
10 0.68
11 0.64
12 0.61
13 0.61
14 0.65
15 0.58
16 0.58
17 0.49
18 0.46
19 0.43
20 0.38
21 0.33
22 0.23
23 0.2
24 0.12
25 0.13
26 0.11
27 0.09
28 0.08
29 0.08
30 0.09
31 0.13
32 0.17
33 0.16
34 0.16
35 0.17
36 0.18
37 0.2
38 0.18
39 0.15
40 0.1
41 0.11
42 0.1
43 0.1
44 0.09
45 0.08
46 0.11
47 0.12
48 0.13
49 0.13
50 0.13
51 0.11
52 0.14
53 0.14
54 0.12
55 0.11
56 0.09
57 0.11
58 0.1
59 0.12
60 0.1
61 0.1
62 0.11
63 0.13
64 0.17
65 0.18
66 0.23
67 0.3
68 0.4
69 0.51
70 0.6
71 0.69
72 0.73
73 0.81
74 0.86
75 0.87
76 0.86
77 0.86
78 0.85
79 0.82
80 0.76
81 0.69
82 0.63
83 0.54
84 0.45
85 0.35
86 0.25
87 0.18
88 0.16
89 0.12
90 0.08
91 0.08
92 0.07
93 0.06
94 0.11
95 0.16
96 0.23
97 0.26
98 0.35
99 0.42
100 0.47
101 0.52
102 0.58
103 0.59
104 0.58
105 0.63
106 0.61
107 0.6
108 0.56
109 0.51
110 0.41