Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K6G3V5

Protein Details
Accession A0A0K6G3V5   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-66EVEKQSSKPKPKHKSKLRFESESHydrophilic
76-105SESGLKSKSKSKSKSKSKSKSESDAHRQQDHydrophilic
NLS Segment(s)
PositionSequence
50-63SKPKPKHKSKLRFE
69-95ESKPQSKSESGLKSKSKSKSKSKSKSK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MHHYIPGGSRRAIGDQGSQPQSRAVELSEGDTANSDGAIEQNAEVEKQSSKPKPKHKSKLRFESESESESKPQSKSESGLKSKSKSKSKSKSKSKSESDAHRQQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.34
4 0.37
5 0.36
6 0.33
7 0.34
8 0.32
9 0.27
10 0.23
11 0.16
12 0.13
13 0.13
14 0.15
15 0.14
16 0.13
17 0.13
18 0.12
19 0.12
20 0.09
21 0.08
22 0.06
23 0.04
24 0.04
25 0.05
26 0.05
27 0.04
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.09
35 0.17
36 0.22
37 0.3
38 0.38
39 0.48
40 0.58
41 0.68
42 0.76
43 0.8
44 0.84
45 0.86
46 0.89
47 0.85
48 0.79
49 0.71
50 0.67
51 0.59
52 0.5
53 0.43
54 0.34
55 0.29
56 0.27
57 0.28
58 0.22
59 0.22
60 0.23
61 0.22
62 0.23
63 0.3
64 0.37
65 0.38
66 0.45
67 0.48
68 0.49
69 0.55
70 0.62
71 0.63
72 0.63
73 0.69
74 0.72
75 0.78
76 0.84
77 0.88
78 0.89
79 0.9
80 0.91
81 0.88
82 0.87
83 0.84
84 0.83
85 0.82
86 0.81