Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O13574

Protein Details
Accession O13574    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-79VVEIRRRGKGKGRKRKREREKGHTKFRIRRRSYBasic
NLS Segment(s)
PositionSequence
51-77RRRGKGKGRKRKREREKGHTKFRIRRR
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MGVGGTRIVSFRQPNYYPVTQQKGASQTGAVAQPYSSYCGLLMRWAVVEIRRRGKGKGRKRKREREKGHTKFRIRRRSYLYFIRSCLVRPYSSGNKKNSCSFHKMLAIEIVLCLKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.42
4 0.42
5 0.46
6 0.49
7 0.44
8 0.44
9 0.45
10 0.42
11 0.39
12 0.34
13 0.26
14 0.2
15 0.2
16 0.2
17 0.16
18 0.12
19 0.1
20 0.11
21 0.12
22 0.14
23 0.11
24 0.1
25 0.1
26 0.1
27 0.11
28 0.11
29 0.1
30 0.07
31 0.07
32 0.08
33 0.08
34 0.11
35 0.17
36 0.2
37 0.25
38 0.3
39 0.31
40 0.33
41 0.42
42 0.48
43 0.53
44 0.6
45 0.65
46 0.72
47 0.81
48 0.9
49 0.92
50 0.93
51 0.91
52 0.91
53 0.91
54 0.89
55 0.89
56 0.88
57 0.85
58 0.82
59 0.83
60 0.83
61 0.77
62 0.75
63 0.73
64 0.71
65 0.68
66 0.69
67 0.66
68 0.58
69 0.55
70 0.49
71 0.42
72 0.36
73 0.36
74 0.29
75 0.22
76 0.21
77 0.27
78 0.36
79 0.45
80 0.51
81 0.53
82 0.57
83 0.61
84 0.66
85 0.66
86 0.62
87 0.61
88 0.56
89 0.55
90 0.54
91 0.5
92 0.45
93 0.41
94 0.35
95 0.27
96 0.25
97 0.2