Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q04210

Protein Details
Accession Q04210    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
138-160DDILKEKLRRKQKYLEELQKKKFBasic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 4, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008417  BAP29/BAP31  
IPR040463  BAP29/BAP31_N  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0006886  P:intracellular protein transport  
GO:0070973  P:protein localization to endoplasmic reticulum exit site  
KEGG sce:YMR040W  -  
Pfam View protein in Pfam  
PF05529  Bap31  
Amino Acid Sequences MGVYLAVLFSLLVIEMAILFILVLPLPQRMRRWLYIRYSIISTNKKFRTYMVGIMIFVGLLFIDSWKRSQIRVSTYRNQKNPYIINSVTPVDALASRAYNQRNVYISGFIIYFYICILTVMSILRRIVEWNDKMKAGDDILKEKLRRKQKYLEELQKKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.02
8 0.03
9 0.03
10 0.03
11 0.04
12 0.08
13 0.11
14 0.15
15 0.18
16 0.25
17 0.3
18 0.37
19 0.41
20 0.44
21 0.49
22 0.53
23 0.53
24 0.49
25 0.46
26 0.43
27 0.46
28 0.47
29 0.44
30 0.44
31 0.45
32 0.45
33 0.43
34 0.4
35 0.41
36 0.36
37 0.37
38 0.33
39 0.3
40 0.27
41 0.27
42 0.26
43 0.17
44 0.14
45 0.09
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.06
53 0.1
54 0.11
55 0.11
56 0.15
57 0.19
58 0.25
59 0.33
60 0.39
61 0.44
62 0.54
63 0.6
64 0.61
65 0.6
66 0.54
67 0.51
68 0.47
69 0.42
70 0.38
71 0.3
72 0.27
73 0.26
74 0.25
75 0.2
76 0.17
77 0.13
78 0.08
79 0.08
80 0.08
81 0.06
82 0.06
83 0.08
84 0.12
85 0.13
86 0.17
87 0.18
88 0.2
89 0.21
90 0.23
91 0.23
92 0.2
93 0.19
94 0.15
95 0.14
96 0.11
97 0.1
98 0.07
99 0.06
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.07
109 0.09
110 0.09
111 0.09
112 0.1
113 0.11
114 0.15
115 0.22
116 0.26
117 0.3
118 0.32
119 0.33
120 0.33
121 0.33
122 0.3
123 0.24
124 0.25
125 0.22
126 0.24
127 0.29
128 0.35
129 0.37
130 0.42
131 0.48
132 0.53
133 0.58
134 0.61
135 0.65
136 0.69
137 0.77
138 0.81
139 0.84
140 0.84