Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53885

Protein Details
Accession P53885    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
119-146EPEAEKRAKKLRKFKIKRVIKTNKQTGEBasic
322-350AKKIEAKKATRPSKPKGTKETPNKGVQKNHydrophilic
NLS Segment(s)
PositionSequence
123-139EKRAKKLRKFKIKRVIK
322-354AKKIEAKKATRPSKPKGTKETPNKGVQKNPAKN
Subcellular Location(s) cyto 11, mito 10.5, cyto_nucl 9.333, mito_nucl 8.666, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032640  AMPK1_CBM  
IPR013783  Ig-like_fold  
IPR014756  Ig_E-set  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0031588  C:nucleotide-activated protein kinase complex  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0019901  F:protein kinase binding  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
GO:0007165  P:signal transduction  
KEGG sce:YNL173C  -  
Pfam View protein in Pfam  
PF16561  AMPK1_CBM  
CDD cd02859  E_set_AMPKbeta_like_N  
Amino Acid Sequences MQSSLPQFTFKWPKGPEAIILTGTFDDWKGTLPMVKDPSGAFEITLPVTFDSPSSKFYFKFIVDGQWLPSKDYKVNIDEGVENNFITEEDVIKQRENGSSTLVPESAGLAVSKNAPLIEPEAEKRAKKLRKFKIKRVIKTNKQTGERSIFSQEVVELPDSEDETQQVNKTGKNADGLSGTTTIIENNVGVNEEKAIKPYEENHPKVNLVKSEGYVTDGLGKTQSSESRLYELSAEDLEKEEEEEDEDKGGGKDTSTSADAEASEDQNKEPLSKSAKFEKPEEKVPVSSITSHAKETSVKPTGKVATETQTYETKQGAPTAAAKKIEAKKATRPSKPKGTKETPNKGVQKNPAKNGGFFKKLAQLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.47
4 0.42
5 0.42
6 0.35
7 0.33
8 0.29
9 0.23
10 0.22
11 0.18
12 0.12
13 0.11
14 0.09
15 0.11
16 0.11
17 0.11
18 0.14
19 0.15
20 0.22
21 0.26
22 0.26
23 0.26
24 0.25
25 0.28
26 0.28
27 0.26
28 0.19
29 0.15
30 0.17
31 0.16
32 0.16
33 0.13
34 0.11
35 0.12
36 0.12
37 0.11
38 0.14
39 0.15
40 0.18
41 0.21
42 0.23
43 0.23
44 0.25
45 0.3
46 0.26
47 0.29
48 0.26
49 0.28
50 0.29
51 0.29
52 0.3
53 0.31
54 0.31
55 0.29
56 0.32
57 0.29
58 0.28
59 0.31
60 0.33
61 0.29
62 0.32
63 0.29
64 0.28
65 0.27
66 0.26
67 0.26
68 0.22
69 0.19
70 0.15
71 0.15
72 0.13
73 0.11
74 0.1
75 0.07
76 0.09
77 0.13
78 0.15
79 0.15
80 0.17
81 0.18
82 0.21
83 0.22
84 0.21
85 0.21
86 0.21
87 0.23
88 0.23
89 0.2
90 0.17
91 0.15
92 0.15
93 0.1
94 0.09
95 0.07
96 0.06
97 0.07
98 0.07
99 0.08
100 0.08
101 0.07
102 0.07
103 0.08
104 0.1
105 0.11
106 0.13
107 0.14
108 0.19
109 0.22
110 0.22
111 0.25
112 0.33
113 0.38
114 0.44
115 0.53
116 0.58
117 0.66
118 0.74
119 0.81
120 0.82
121 0.85
122 0.84
123 0.85
124 0.85
125 0.83
126 0.85
127 0.83
128 0.8
129 0.75
130 0.69
131 0.63
132 0.59
133 0.5
134 0.43
135 0.37
136 0.3
137 0.25
138 0.23
139 0.18
140 0.12
141 0.12
142 0.1
143 0.07
144 0.07
145 0.08
146 0.08
147 0.09
148 0.08
149 0.08
150 0.08
151 0.09
152 0.09
153 0.13
154 0.13
155 0.13
156 0.15
157 0.16
158 0.16
159 0.17
160 0.17
161 0.14
162 0.14
163 0.13
164 0.13
165 0.12
166 0.11
167 0.08
168 0.08
169 0.07
170 0.06
171 0.06
172 0.05
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.07
181 0.08
182 0.09
183 0.09
184 0.1
185 0.13
186 0.22
187 0.3
188 0.32
189 0.33
190 0.34
191 0.35
192 0.37
193 0.37
194 0.28
195 0.23
196 0.22
197 0.2
198 0.2
199 0.19
200 0.17
201 0.15
202 0.13
203 0.15
204 0.14
205 0.13
206 0.12
207 0.12
208 0.11
209 0.13
210 0.15
211 0.12
212 0.15
213 0.15
214 0.18
215 0.18
216 0.17
217 0.16
218 0.15
219 0.13
220 0.11
221 0.1
222 0.08
223 0.09
224 0.09
225 0.08
226 0.08
227 0.07
228 0.06
229 0.08
230 0.09
231 0.08
232 0.08
233 0.09
234 0.09
235 0.09
236 0.1
237 0.08
238 0.07
239 0.08
240 0.09
241 0.11
242 0.11
243 0.12
244 0.11
245 0.11
246 0.11
247 0.12
248 0.13
249 0.12
250 0.13
251 0.14
252 0.13
253 0.16
254 0.16
255 0.15
256 0.15
257 0.19
258 0.23
259 0.27
260 0.31
261 0.38
262 0.44
263 0.46
264 0.51
265 0.54
266 0.52
267 0.56
268 0.58
269 0.51
270 0.46
271 0.45
272 0.43
273 0.36
274 0.32
275 0.28
276 0.28
277 0.27
278 0.27
279 0.26
280 0.23
281 0.25
282 0.27
283 0.32
284 0.34
285 0.33
286 0.33
287 0.38
288 0.4
289 0.38
290 0.38
291 0.33
292 0.31
293 0.33
294 0.34
295 0.31
296 0.32
297 0.31
298 0.3
299 0.29
300 0.26
301 0.24
302 0.25
303 0.23
304 0.2
305 0.26
306 0.29
307 0.32
308 0.31
309 0.3
310 0.37
311 0.42
312 0.49
313 0.48
314 0.47
315 0.52
316 0.62
317 0.71
318 0.71
319 0.73
320 0.74
321 0.78
322 0.84
323 0.83
324 0.83
325 0.83
326 0.83
327 0.86
328 0.87
329 0.84
330 0.84
331 0.83
332 0.79
333 0.78
334 0.78
335 0.78
336 0.76
337 0.75
338 0.75
339 0.69
340 0.67
341 0.69
342 0.67
343 0.61
344 0.53
345 0.51
346 0.49