Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q12476

Protein Details
Accession Q12476    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-142GHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAHydrophilic
229-249EDPLPRPSHKRHSQNDHSHSGBasic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016713  Air1/2_Saccharomycetales  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0031499  C:TRAMP complex  
GO:0060090  F:molecular adaptor activity  
GO:0030674  F:protein-macromolecule adaptor activity  
GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
GO:0043629  P:ncRNA polyadenylation  
GO:0071031  P:nuclear mRNA surveillance of mRNA 3'-end processing  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071035  P:nuclear polyadenylation-dependent rRNA catabolic process  
GO:0071036  P:nuclear polyadenylation-dependent snoRNA catabolic process  
GO:0071037  P:nuclear polyadenylation-dependent snRNA catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
GO:0000292  P:RNA fragment catabolic process  
GO:0043631  P:RNA polyadenylation  
GO:0006400  P:tRNA modification  
KEGG sce:YDL175C  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MEKNTAPFVVDTAPTTPPDKLVAPSIEEVNSNPNELRALRGQGRYFGVSDDDKDAIKEAAPKCNNCSQRGHLKKDCPHIICSYCGATDDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPKVLPFHTIYCYNCGGKGHFGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRYQNTKVNVSSISENMYGSRYNPSTYVDNNSISNSSNYRNYNSYQPYRSGTLGKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.21
4 0.19
5 0.22
6 0.22
7 0.21
8 0.25
9 0.25
10 0.26
11 0.27
12 0.28
13 0.26
14 0.24
15 0.23
16 0.24
17 0.23
18 0.21
19 0.19
20 0.18
21 0.2
22 0.19
23 0.23
24 0.2
25 0.26
26 0.3
27 0.36
28 0.36
29 0.38
30 0.41
31 0.38
32 0.34
33 0.29
34 0.27
35 0.22
36 0.23
37 0.22
38 0.2
39 0.18
40 0.18
41 0.19
42 0.15
43 0.15
44 0.21
45 0.2
46 0.29
47 0.34
48 0.35
49 0.39
50 0.47
51 0.51
52 0.47
53 0.5
54 0.47
55 0.53
56 0.6
57 0.64
58 0.63
59 0.67
60 0.7
61 0.74
62 0.76
63 0.67
64 0.62
65 0.59
66 0.53
67 0.46
68 0.41
69 0.33
70 0.25
71 0.23
72 0.2
73 0.16
74 0.2
75 0.2
76 0.2
77 0.21
78 0.26
79 0.29
80 0.33
81 0.33
82 0.3
83 0.34
84 0.42
85 0.49
86 0.49
87 0.48
88 0.5
89 0.5
90 0.5
91 0.45
92 0.37
93 0.36
94 0.36
95 0.41
96 0.36
97 0.37
98 0.4
99 0.45
100 0.48
101 0.5
102 0.55
103 0.58
104 0.65
105 0.7
106 0.74
107 0.79
108 0.83
109 0.82
110 0.82
111 0.82
112 0.81
113 0.82
114 0.79
115 0.78
116 0.79
117 0.81
118 0.82
119 0.81
120 0.83
121 0.84
122 0.85
123 0.82
124 0.77
125 0.73
126 0.67
127 0.58
128 0.48
129 0.4
130 0.33
131 0.28
132 0.23
133 0.18
134 0.13
135 0.14
136 0.14
137 0.15
138 0.13
139 0.13
140 0.15
141 0.16
142 0.23
143 0.24
144 0.29
145 0.3
146 0.34
147 0.35
148 0.36
149 0.34
150 0.3
151 0.29
152 0.23
153 0.21
154 0.18
155 0.16
156 0.15
157 0.15
158 0.13
159 0.13
160 0.13
161 0.15
162 0.2
163 0.21
164 0.22
165 0.25
166 0.24
167 0.27
168 0.35
169 0.41
170 0.43
171 0.51
172 0.5
173 0.49
174 0.51
175 0.47
176 0.39
177 0.32
178 0.25
179 0.15
180 0.13
181 0.11
182 0.09
183 0.08
184 0.08
185 0.07
186 0.06
187 0.07
188 0.08
189 0.09
190 0.11
191 0.11
192 0.15
193 0.21
194 0.27
195 0.32
196 0.36
197 0.4
198 0.4
199 0.47
200 0.46
201 0.43
202 0.39
203 0.34
204 0.31
205 0.27
206 0.27
207 0.2
208 0.18
209 0.13
210 0.12
211 0.11
212 0.1
213 0.1
214 0.1
215 0.09
216 0.11
217 0.13
218 0.14
219 0.15
220 0.18
221 0.22
222 0.28
223 0.38
224 0.45
225 0.53
226 0.6
227 0.69
228 0.76
229 0.81
230 0.81
231 0.78
232 0.72
233 0.68
234 0.66
235 0.66
236 0.64
237 0.63
238 0.64
239 0.64
240 0.7
241 0.73
242 0.75
243 0.76
244 0.77
245 0.77
246 0.78
247 0.73
248 0.72
249 0.7
250 0.66
251 0.59
252 0.52
253 0.53
254 0.51
255 0.51
256 0.45
257 0.4
258 0.43
259 0.42
260 0.38
261 0.29
262 0.23
263 0.24
264 0.27
265 0.3
266 0.25
267 0.24
268 0.27
269 0.28
270 0.29
271 0.27
272 0.25
273 0.26
274 0.31
275 0.36
276 0.4
277 0.43
278 0.5
279 0.54
280 0.59
281 0.54
282 0.51
283 0.45
284 0.41
285 0.4
286 0.31
287 0.29
288 0.22
289 0.21
290 0.19
291 0.19
292 0.17
293 0.15
294 0.21
295 0.19
296 0.19
297 0.21
298 0.24
299 0.26
300 0.28
301 0.34
302 0.31
303 0.32
304 0.31
305 0.32
306 0.3
307 0.27
308 0.28
309 0.24
310 0.24
311 0.3
312 0.32
313 0.34
314 0.36
315 0.37
316 0.44
317 0.49
318 0.53
319 0.5
320 0.52
321 0.52
322 0.52
323 0.52
324 0.51