Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P07213

Protein Details
Accession P07213    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-55QLQQQQQRGKKNTINKDEKKDTKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 7, cyto_nucl 7, cyto 4, vacu 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005687  Tom70  
IPR011990  TPR-like_helical_dom_sf  
IPR001440  TPR_1  
IPR019734  TPR_repeat  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0005739  C:mitochondrion  
GO:0030943  F:mitochondrion targeting sequence binding  
GO:0015450  F:protein-transporting ATPase activity  
GO:0030150  P:protein import into mitochondrial matrix  
GO:0045039  P:protein insertion into mitochondrial inner membrane  
GO:0045040  P:protein insertion into mitochondrial outer membrane  
GO:0006626  P:protein targeting to mitochondrion  
KEGG sce:YNL121C  -  
Pfam View protein in Pfam  
PF00515  TPR_1  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50293  TPR_REGION  
Amino Acid Sequences MKSFITRNKTAILATVAATGTAIGAYYYYNQLQQQQQRGKKNTINKDEKKDTKDSQKETEGAKKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLREQGLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.17
5 0.16
6 0.12
7 0.09
8 0.07
9 0.06
10 0.03
11 0.04
12 0.05
13 0.07
14 0.11
15 0.12
16 0.15
17 0.17
18 0.24
19 0.32
20 0.39
21 0.47
22 0.54
23 0.61
24 0.68
25 0.73
26 0.75
27 0.74
28 0.77
29 0.77
30 0.78
31 0.81
32 0.79
33 0.83
34 0.85
35 0.86
36 0.82
37 0.8
38 0.77
39 0.77
40 0.78
41 0.74
42 0.71
43 0.68
44 0.66
45 0.63
46 0.65
47 0.6
48 0.53
49 0.5
50 0.47
51 0.44
52 0.47
53 0.47
54 0.43
55 0.44
56 0.49
57 0.48
58 0.46
59 0.44
60 0.41
61 0.38
62 0.36
63 0.35
64 0.3
65 0.31
66 0.29
67 0.29
68 0.25
69 0.26
70 0.29
71 0.23
72 0.24
73 0.21
74 0.22
75 0.22
76 0.23
77 0.24
78 0.26
79 0.3
80 0.31
81 0.32
82 0.32
83 0.3
84 0.3
85 0.32
86 0.27
87 0.27
88 0.3
89 0.31
90 0.38
91 0.42
92 0.48
93 0.48
94 0.51
95 0.55
96 0.57
97 0.62
98 0.63
99 0.61
100 0.58
101 0.59
102 0.61
103 0.58
104 0.56
105 0.53
106 0.46
107 0.47
108 0.44
109 0.38
110 0.31
111 0.25
112 0.18
113 0.18
114 0.19
115 0.18
116 0.19
117 0.18
118 0.17
119 0.18
120 0.18
121 0.14
122 0.16
123 0.15
124 0.14
125 0.15
126 0.15
127 0.13
128 0.13
129 0.13
130 0.1
131 0.14
132 0.14
133 0.13
134 0.15
135 0.15
136 0.15
137 0.16
138 0.15
139 0.15
140 0.15
141 0.18
142 0.18
143 0.19
144 0.19
145 0.19
146 0.21
147 0.19
148 0.22
149 0.22
150 0.22
151 0.22
152 0.23
153 0.27
154 0.28
155 0.34
156 0.33
157 0.31
158 0.34
159 0.36
160 0.39
161 0.36
162 0.34
163 0.31
164 0.28
165 0.28
166 0.23
167 0.2
168 0.15
169 0.13
170 0.12
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.05
177 0.06
178 0.05
179 0.05
180 0.04
181 0.05
182 0.05
183 0.06
184 0.06
185 0.05
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.06
192 0.07
193 0.08
194 0.09
195 0.1
196 0.13
197 0.19
198 0.2
199 0.2
200 0.22
201 0.28
202 0.33
203 0.37
204 0.4
205 0.36
206 0.41
207 0.42
208 0.4
209 0.37
210 0.3
211 0.31
212 0.25
213 0.23
214 0.19
215 0.17
216 0.17
217 0.13
218 0.12
219 0.07
220 0.06
221 0.07
222 0.07
223 0.09
224 0.12
225 0.13
226 0.19
227 0.25
228 0.29
229 0.35
230 0.43
231 0.51
232 0.59
233 0.62
234 0.65
235 0.69
236 0.69
237 0.65
238 0.58
239 0.48
240 0.38
241 0.33
242 0.25
243 0.15
244 0.12
245 0.08
246 0.07
247 0.07
248 0.07
249 0.09
250 0.08
251 0.08
252 0.09
253 0.1
254 0.1
255 0.12
256 0.12
257 0.11
258 0.15
259 0.14
260 0.13
261 0.13
262 0.13
263 0.12
264 0.11
265 0.11
266 0.07
267 0.07
268 0.07
269 0.08
270 0.07
271 0.06
272 0.06
273 0.06
274 0.09
275 0.1
276 0.11
277 0.11
278 0.11
279 0.12
280 0.15
281 0.18
282 0.2
283 0.23
284 0.26
285 0.28
286 0.28
287 0.28
288 0.27
289 0.23
290 0.23
291 0.21
292 0.17
293 0.16
294 0.16
295 0.16
296 0.16
297 0.18
298 0.16
299 0.16
300 0.22
301 0.19
302 0.23
303 0.26
304 0.25
305 0.23
306 0.24
307 0.23
308 0.18
309 0.19
310 0.18
311 0.18
312 0.18
313 0.2
314 0.18
315 0.2
316 0.21
317 0.21
318 0.2
319 0.2
320 0.2
321 0.19
322 0.18
323 0.15
324 0.14
325 0.13
326 0.11
327 0.11
328 0.12
329 0.16
330 0.16
331 0.18
332 0.17
333 0.2
334 0.23
335 0.22
336 0.23
337 0.2
338 0.21
339 0.2
340 0.2
341 0.16
342 0.13
343 0.15
344 0.15
345 0.16
346 0.16
347 0.18
348 0.21
349 0.21
350 0.21
351 0.18
352 0.16
353 0.15
354 0.13
355 0.11
356 0.08
357 0.08
358 0.08
359 0.08
360 0.06
361 0.05
362 0.05
363 0.06
364 0.07
365 0.07
366 0.08
367 0.1
368 0.11
369 0.13
370 0.15
371 0.14
372 0.15
373 0.16
374 0.15
375 0.14
376 0.16
377 0.16
378 0.16
379 0.21
380 0.22
381 0.24
382 0.24
383 0.23
384 0.22
385 0.2
386 0.23
387 0.19
388 0.2
389 0.21
390 0.21
391 0.21
392 0.22
393 0.28
394 0.26
395 0.24
396 0.24
397 0.2
398 0.22
399 0.22
400 0.22
401 0.16
402 0.14
403 0.16
404 0.14
405 0.18
406 0.21
407 0.19
408 0.22
409 0.23
410 0.24
411 0.3
412 0.31
413 0.34
414 0.31
415 0.33
416 0.3
417 0.3
418 0.28
419 0.19
420 0.19
421 0.13
422 0.11
423 0.09
424 0.08
425 0.07
426 0.09
427 0.11
428 0.14
429 0.16
430 0.19
431 0.2
432 0.21
433 0.23
434 0.24
435 0.25
436 0.22
437 0.22
438 0.21
439 0.23
440 0.22
441 0.21
442 0.28
443 0.26
444 0.29
445 0.31
446 0.32
447 0.32
448 0.34
449 0.44
450 0.41
451 0.47
452 0.49
453 0.5
454 0.48
455 0.44
456 0.41
457 0.3
458 0.25
459 0.18
460 0.13
461 0.1
462 0.12
463 0.13
464 0.13
465 0.14
466 0.15
467 0.15
468 0.15
469 0.2
470 0.2
471 0.24
472 0.24
473 0.24
474 0.25
475 0.26
476 0.26
477 0.2
478 0.18
479 0.15
480 0.16
481 0.16
482 0.14
483 0.12
484 0.09
485 0.09
486 0.07
487 0.06
488 0.06
489 0.05
490 0.06
491 0.05
492 0.06
493 0.05
494 0.06
495 0.06
496 0.05
497 0.04
498 0.05
499 0.08
500 0.13
501 0.15
502 0.19
503 0.2
504 0.23
505 0.25
506 0.25
507 0.27
508 0.23
509 0.24
510 0.22
511 0.2
512 0.18
513 0.16
514 0.17
515 0.14
516 0.14
517 0.11
518 0.12
519 0.11
520 0.14
521 0.2
522 0.23
523 0.23
524 0.29
525 0.33
526 0.37
527 0.43
528 0.41
529 0.38
530 0.36
531 0.39
532 0.33
533 0.36
534 0.35
535 0.3
536 0.31
537 0.34
538 0.36
539 0.31
540 0.31
541 0.25
542 0.21
543 0.23
544 0.21
545 0.16
546 0.12
547 0.11
548 0.11
549 0.1
550 0.09
551 0.06
552 0.05
553 0.05
554 0.05
555 0.06
556 0.08
557 0.07
558 0.08
559 0.08
560 0.09
561 0.11
562 0.14
563 0.16
564 0.15
565 0.17
566 0.17
567 0.17
568 0.17
569 0.17
570 0.14
571 0.12
572 0.12
573 0.11
574 0.12
575 0.17
576 0.21
577 0.22
578 0.25
579 0.29
580 0.34
581 0.39
582 0.42
583 0.42
584 0.44
585 0.52
586 0.55
587 0.52
588 0.5
589 0.47
590 0.47
591 0.47
592 0.45
593 0.41
594 0.44
595 0.5
596 0.49
597 0.47