Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P0CX37

Protein Details
Accession P0CX37    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-100VSCYRPRRDGERKRKSVRGABasic
176-202QRLVTPQRLQRKRHQRALKVRNAQAQRHydrophilic
NLS Segment(s)
PositionSequence
89-95DGERKRK
214-236KRLSERKAEKAEIRKRRASSLKA
Subcellular Location(s) cyto 13.5cyto_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0032040  C:small-subunit processome  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG sce:YBR181C  -  
sce:YPL090C  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.23
4 0.24
5 0.26
6 0.33
7 0.34
8 0.34
9 0.32
10 0.31
11 0.31
12 0.34
13 0.35
14 0.3
15 0.33
16 0.37
17 0.38
18 0.44
19 0.45
20 0.37
21 0.36
22 0.33
23 0.28
24 0.21
25 0.19
26 0.13
27 0.11
28 0.11
29 0.07
30 0.06
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.11
39 0.14
40 0.22
41 0.23
42 0.28
43 0.28
44 0.29
45 0.3
46 0.34
47 0.32
48 0.27
49 0.31
50 0.26
51 0.27
52 0.27
53 0.27
54 0.23
55 0.26
56 0.25
57 0.2
58 0.21
59 0.18
60 0.18
61 0.18
62 0.2
63 0.25
64 0.29
65 0.29
66 0.34
67 0.39
68 0.41
69 0.43
70 0.45
71 0.44
72 0.48
73 0.48
74 0.52
75 0.57
76 0.66
77 0.72
78 0.76
79 0.79
80 0.76
81 0.8
82 0.75
83 0.71
84 0.64
85 0.59
86 0.5
87 0.42
88 0.37
89 0.31
90 0.27
91 0.2
92 0.15
93 0.08
94 0.06
95 0.03
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.11
116 0.1
117 0.11
118 0.2
119 0.25
120 0.33
121 0.4
122 0.48
123 0.56
124 0.66
125 0.74
126 0.72
127 0.73
128 0.66
129 0.6
130 0.55
131 0.46
132 0.42
133 0.36
134 0.31
135 0.31
136 0.32
137 0.31
138 0.28
139 0.28
140 0.23
141 0.23
142 0.21
143 0.17
144 0.2
145 0.2
146 0.21
147 0.23
148 0.24
149 0.26
150 0.32
151 0.33
152 0.3
153 0.34
154 0.36
155 0.41
156 0.48
157 0.48
158 0.49
159 0.52
160 0.58
161 0.6
162 0.62
163 0.59
164 0.6
165 0.64
166 0.66
167 0.67
168 0.65
169 0.69
170 0.72
171 0.72
172 0.72
173 0.74
174 0.75
175 0.78
176 0.81
177 0.8
178 0.83
179 0.88
180 0.88
181 0.86
182 0.82
183 0.8
184 0.76
185 0.69
186 0.64
187 0.56
188 0.46
189 0.38
190 0.33
191 0.25
192 0.2
193 0.17
194 0.12
195 0.11
196 0.12
197 0.11
198 0.12
199 0.12
200 0.14
201 0.2
202 0.24
203 0.27
204 0.35
205 0.4
206 0.47
207 0.54
208 0.58
209 0.6
210 0.66
211 0.72
212 0.74
213 0.76
214 0.76
215 0.71
216 0.74