FuNGI

Q04712

Protein Details

Accession

Q04712

Localization Confidence

Medium

Confidence Score

13.9

NoLS Segment(s)

Position	Sequence	Protein Nature
5-31	PITLTNRKFAQRRKLKYQYINYISRRF	Hydrophilic
64-91	EAGTYRRSVLQQKKRRRERHWRSVVGEI	Hydrophilic

NLS Segment(s)

Position	Sequence
76-81	KKRRRE

Subcellular Location(s)

nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR007224 TIF_Rrn11 IPR016850 TIF_Rrn11_budding_yeast
Gene Ontology	GO:0005730 C:nucleolus GO:0005634 C:nucleus GO:0070860 C:RNA polymerase I core factor complex GO:0001164 F:RNA polymerase I core promoter sequence-specific DNA binding GO:0001181 F:RNA polymerase I general transcription initiation factor activity GO:0017025 F:TBP-class protein binding GO:0042790 P:nucleolar large rRNA transcription by RNA polymerase I
KEGG	sce:YML043C -
Pfam	View protein in Pfam PF04090 RNA_pol_I_TF

Amino Acid Sequences

MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.57
2	0.62
3	0.7
4	0.77
5	0.83
6	0.85
7	0.87
8	0.88
9	0.88
10	0.85
11	0.86
12	0.81
13	0.78
14	0.73
15	0.68
16	0.63
17	0.55
18	0.56
19	0.57
20	0.6
21	0.59
22	0.62
23	0.63
24	0.63
25	0.65
26	0.62
27	0.56
28	0.53
29	0.51
30	0.47
31	0.45
32	0.41
33	0.39
34	0.35
35	0.31
36	0.26
37	0.25
38	0.22
39	0.22
40	0.22
41	0.19
42	0.18
43	0.17
44	0.16
45	0.15
46	0.15
47	0.12
48	0.12
49	0.1
50	0.1
51	0.14
52	0.14
53	0.14
54	0.14
55	0.15
56	0.17
57	0.22
58	0.31
59	0.38
60	0.48
61	0.57
62	0.67
63	0.77
64	0.84
65	0.9
66	0.91
67	0.92
68	0.92
69	0.93
70	0.93
71	0.89
72	0.82
73	0.8
74	0.73
75	0.63
76	0.53
77	0.42
78	0.35
79	0.28
80	0.24
81	0.16
82	0.13
83	0.12
84	0.12
85	0.13
86	0.12
87	0.12
88	0.13
89	0.13
90	0.13
91	0.13
92	0.11
93	0.1
94	0.09
95	0.08
96	0.09
97	0.08
98	0.07
99	0.07
100	0.08
101	0.08
102	0.1
103	0.1
104	0.09
105	0.1
106	0.13
107	0.16
108	0.19
109	0.2
110	0.19
111	0.27
112	0.31
113	0.32
114	0.34
115	0.42
116	0.44
117	0.55
118	0.65
119	0.68
120	0.68
121	0.74
122	0.75
123	0.69
124	0.7
125	0.62
126	0.59
127	0.49
128	0.45
129	0.42
130	0.41
131	0.43
132	0.39
133	0.43
134	0.43
135	0.49
136	0.5
137	0.54
138	0.6
139	0.62
140	0.64
141	0.61
142	0.6
143	0.64
144	0.67
145	0.69
146	0.66
147	0.67
148	0.67
149	0.64
150	0.64
151	0.6
152	0.65
153	0.63
154	0.63
155	0.62
156	0.65
157	0.7
158	0.66
159	0.61
160	0.57
161	0.53
162	0.48
163	0.46
164	0.42
165	0.36
166	0.35
167	0.35
168	0.32
169	0.36
170	0.35
171	0.31
172	0.3
173	0.32
174	0.32
175	0.32
176	0.32
177	0.27
178	0.27
179	0.25
180	0.24
181	0.2
182	0.22
183	0.2
184	0.19
185	0.17
186	0.16
187	0.16
188	0.2
189	0.24
190	0.27
191	0.28
192	0.32
193	0.37
194	0.39
195	0.41
196	0.43
197	0.4
198	0.36
199	0.36
200	0.32
201	0.27
202	0.3
203	0.27
204	0.21
205	0.2
206	0.18
207	0.16
208	0.15
209	0.13
210	0.1
211	0.11
212	0.12
213	0.12
214	0.13
215	0.12
216	0.13
217	0.16
218	0.14
219	0.15
220	0.13
221	0.13
222	0.14
223	0.13
224	0.16
225	0.14
226	0.14
227	0.13
228	0.13
229	0.12
230	0.16
231	0.16
232	0.14
233	0.12
234	0.12
235	0.12
236	0.12
237	0.11
238	0.06
239	0.06
240	0.05
241	0.05
242	0.04
243	0.03
244	0.04
245	0.04
246	0.04
247	0.04
248	0.04
249	0.03
250	0.03
251	0.04
252	0.04
253	0.04
254	0.05
255	0.05
256	0.05
257	0.06
258	0.07
259	0.07
260	0.08
261	0.07
262	0.08
263	0.09
264	0.11
265	0.2
266	0.2
267	0.23
268	0.25
269	0.28
270	0.29
271	0.31
272	0.39
273	0.39
274	0.42
275	0.42
276	0.4
277	0.38
278	0.37
279	0.36
280	0.28
281	0.2
282	0.17
283	0.15
284	0.16
285	0.18
286	0.18
287	0.22
288	0.27
289	0.27
290	0.25
291	0.27
292	0.27
293	0.25
294	0.24
295	0.19
296	0.14
297	0.13
298	0.13
299	0.11
300	0.11
301	0.1
302	0.1
303	0.14
304	0.2
305	0.2
306	0.2
307	0.2
308	0.2
309	0.23
310	0.26
311	0.25
312	0.2
313	0.22
314	0.25
315	0.28
316	0.26
317	0.24
318	0.22
319	0.18
320	0.2
321	0.18
322	0.16
323	0.16
324	0.16
325	0.17
326	0.18
327	0.18
328	0.14
329	0.13
330	0.13
331	0.1
332	0.09
333	0.08
334	0.06
335	0.06
336	0.07
337	0.07
338	0.07
339	0.09
340	0.09
341	0.1
342	0.1
343	0.1
344	0.1
345	0.1
346	0.1
347	0.08
348	0.09
349	0.13
350	0.12
351	0.11
352	0.11
353	0.11
354	0.1
355	0.11
356	0.1
357	0.07
358	0.08
359	0.08
360	0.08
361	0.09
362	0.12
363	0.16
364	0.2
365	0.22
366	0.23
367	0.24
368	0.25
369	0.27
370	0.28
371	0.33
372	0.34
373	0.36
374	0.36
375	0.38
376	0.36
377	0.34
378	0.29
379	0.21
380	0.17
381	0.16
382	0.16
383	0.15
384	0.17
385	0.17
386	0.17
387	0.2
388	0.23
389	0.21
390	0.26
391	0.28
392	0.29
393	0.39
394	0.41
395	0.42
396	0.38
397	0.41
398	0.36
399	0.42
400	0.41
401	0.33
402	0.38
403	0.36
404	0.35
405	0.39
406	0.37
407	0.29
408	0.29
409	0.31
410	0.24
411	0.21
412	0.23
413	0.16
414	0.17
415	0.18
416	0.18
417	0.2
418	0.24
419	0.28
420	0.3
421	0.32
422	0.31
423	0.31
424	0.32
425	0.29
426	0.27
427	0.24
428	0.21
429	0.22
430	0.21
431	0.22
432	0.25
433	0.25
434	0.27
435	0.25
436	0.24
437	0.23
438	0.22
439	0.22
440	0.19
441	0.17
442	0.14
443	0.15
444	0.16
445	0.16
446	0.16
447	0.19
448	0.17
449	0.17
450	0.16
451	0.17
452	0.15
453	0.13
454	0.13
455	0.1
456	0.1
457	0.1
458	0.11
459	0.1
460	0.12
461	0.16
462	0.16
463	0.16
464	0.15
465	0.15
466	0.13
467	0.14
468	0.16
469	0.11
470	0.11
471	0.12
472	0.12
473	0.12
474	0.12
475	0.13
476	0.08
477	0.09
478	0.08
479	0.08
480	0.08
481	0.08
482	0.09
483	0.08
484	0.09
485	0.1
486	0.1
487	0.11

Q04712

3D AlphaFold-predicted Structure Viewer