Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q04712

Protein Details
Accession Q04712    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-31PITLTNRKFAQRRKLKYQYINYISRRFHydrophilic
64-91EAGTYRRSVLQQKKRRRERHWRSVVGEIHydrophilic
NLS Segment(s)
PositionSequence
76-81KKRRRE
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007224  TIF_Rrn11  
IPR016850  TIF_Rrn11_budding_yeast  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0070860  C:RNA polymerase I core factor complex  
GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
GO:0017025  F:TBP-class protein binding  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
KEGG sce:YML043C  -  
Pfam View protein in Pfam  
PF04090  RNA_pol_I_TF  
Amino Acid Sequences MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.7
4 0.77
5 0.83
6 0.85
7 0.87
8 0.88
9 0.88
10 0.85
11 0.86
12 0.81
13 0.78
14 0.73
15 0.68
16 0.63
17 0.55
18 0.56
19 0.57
20 0.6
21 0.59
22 0.62
23 0.63
24 0.63
25 0.65
26 0.62
27 0.56
28 0.53
29 0.51
30 0.47
31 0.45
32 0.41
33 0.39
34 0.35
35 0.31
36 0.26
37 0.25
38 0.22
39 0.22
40 0.22
41 0.19
42 0.18
43 0.17
44 0.16
45 0.15
46 0.15
47 0.12
48 0.12
49 0.1
50 0.1
51 0.14
52 0.14
53 0.14
54 0.14
55 0.15
56 0.17
57 0.22
58 0.31
59 0.38
60 0.48
61 0.57
62 0.67
63 0.77
64 0.84
65 0.9
66 0.91
67 0.92
68 0.92
69 0.93
70 0.93
71 0.89
72 0.82
73 0.8
74 0.73
75 0.63
76 0.53
77 0.42
78 0.35
79 0.28
80 0.24
81 0.16
82 0.13
83 0.12
84 0.12
85 0.13
86 0.12
87 0.12
88 0.13
89 0.13
90 0.13
91 0.13
92 0.11
93 0.1
94 0.09
95 0.08
96 0.09
97 0.08
98 0.07
99 0.07
100 0.08
101 0.08
102 0.1
103 0.1
104 0.09
105 0.1
106 0.13
107 0.16
108 0.19
109 0.2
110 0.19
111 0.27
112 0.31
113 0.32
114 0.34
115 0.42
116 0.44
117 0.55
118 0.65
119 0.68
120 0.68
121 0.74
122 0.75
123 0.69
124 0.7
125 0.62
126 0.59
127 0.49
128 0.45
129 0.42
130 0.41
131 0.43
132 0.39
133 0.43
134 0.43
135 0.49
136 0.5
137 0.54
138 0.6
139 0.62
140 0.64
141 0.61
142 0.6
143 0.64
144 0.67
145 0.69
146 0.66
147 0.67
148 0.67
149 0.64
150 0.64
151 0.6
152 0.65
153 0.63
154 0.63
155 0.62
156 0.65
157 0.7
158 0.66
159 0.61
160 0.57
161 0.53
162 0.48
163 0.46
164 0.42
165 0.36
166 0.35
167 0.35
168 0.32
169 0.36
170 0.35
171 0.31
172 0.3
173 0.32
174 0.32
175 0.32
176 0.32
177 0.27
178 0.27
179 0.25
180 0.24
181 0.2
182 0.22
183 0.2
184 0.19
185 0.17
186 0.16
187 0.16
188 0.2
189 0.24
190 0.27
191 0.28
192 0.32
193 0.37
194 0.39
195 0.41
196 0.43
197 0.4
198 0.36
199 0.36
200 0.32
201 0.27
202 0.3
203 0.27
204 0.21
205 0.2
206 0.18
207 0.16
208 0.15
209 0.13
210 0.1
211 0.11
212 0.12
213 0.12
214 0.13
215 0.12
216 0.13
217 0.16
218 0.14
219 0.15
220 0.13
221 0.13
222 0.14
223 0.13
224 0.16
225 0.14
226 0.14
227 0.13
228 0.13
229 0.12
230 0.16
231 0.16
232 0.14
233 0.12
234 0.12
235 0.12
236 0.12
237 0.11
238 0.06
239 0.06
240 0.05
241 0.05
242 0.04
243 0.03
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.03
250 0.03
251 0.04
252 0.04
253 0.04
254 0.05
255 0.05
256 0.05
257 0.06
258 0.07
259 0.07
260 0.08
261 0.07
262 0.08
263 0.09
264 0.11
265 0.2
266 0.2
267 0.23
268 0.25
269 0.28
270 0.29
271 0.31
272 0.39
273 0.39
274 0.42
275 0.42
276 0.4
277 0.38
278 0.37
279 0.36
280 0.28
281 0.2
282 0.17
283 0.15
284 0.16
285 0.18
286 0.18
287 0.22
288 0.27
289 0.27
290 0.25
291 0.27
292 0.27
293 0.25
294 0.24
295 0.19
296 0.14
297 0.13
298 0.13
299 0.11
300 0.11
301 0.1
302 0.1
303 0.14
304 0.2
305 0.2
306 0.2
307 0.2
308 0.2
309 0.23
310 0.26
311 0.25
312 0.2
313 0.22
314 0.25
315 0.28
316 0.26
317 0.24
318 0.22
319 0.18
320 0.2
321 0.18
322 0.16
323 0.16
324 0.16
325 0.17
326 0.18
327 0.18
328 0.14
329 0.13
330 0.13
331 0.1
332 0.09
333 0.08
334 0.06
335 0.06
336 0.07
337 0.07
338 0.07
339 0.09
340 0.09
341 0.1
342 0.1
343 0.1
344 0.1
345 0.1
346 0.1
347 0.08
348 0.09
349 0.13
350 0.12
351 0.11
352 0.11
353 0.11
354 0.1
355 0.11
356 0.1
357 0.07
358 0.08
359 0.08
360 0.08
361 0.09
362 0.12
363 0.16
364 0.2
365 0.22
366 0.23
367 0.24
368 0.25
369 0.27
370 0.28
371 0.33
372 0.34
373 0.36
374 0.36
375 0.38
376 0.36
377 0.34
378 0.29
379 0.21
380 0.17
381 0.16
382 0.16
383 0.15
384 0.17
385 0.17
386 0.17
387 0.2
388 0.23
389 0.21
390 0.26
391 0.28
392 0.29
393 0.39
394 0.41
395 0.42
396 0.38
397 0.41
398 0.36
399 0.42
400 0.41
401 0.33
402 0.38
403 0.36
404 0.35
405 0.39
406 0.37
407 0.29
408 0.29
409 0.31
410 0.24
411 0.21
412 0.23
413 0.16
414 0.17
415 0.18
416 0.18
417 0.2
418 0.24
419 0.28
420 0.3
421 0.32
422 0.31
423 0.31
424 0.32
425 0.29
426 0.27
427 0.24
428 0.21
429 0.22
430 0.21
431 0.22
432 0.25
433 0.25
434 0.27
435 0.25
436 0.24
437 0.23
438 0.22
439 0.22
440 0.19
441 0.17
442 0.14
443 0.15
444 0.16
445 0.16
446 0.16
447 0.19
448 0.17
449 0.17
450 0.16
451 0.17
452 0.15
453 0.13
454 0.13
455 0.1
456 0.1
457 0.1
458 0.11
459 0.1
460 0.12
461 0.16
462 0.16
463 0.16
464 0.15
465 0.15
466 0.13
467 0.14
468 0.16
469 0.11
470 0.11
471 0.12
472 0.12
473 0.12
474 0.12
475 0.13
476 0.08
477 0.09
478 0.08
479 0.08
480 0.08
481 0.08
482 0.09
483 0.08
484 0.09
485 0.1
486 0.1
487 0.11