Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q3E765

Protein Details
Accession Q3E765   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-64SKKEKETKFKHLHYQKRSCFBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG sce:YKL183C-A  -  
Amino Acid Sequences MYSKILLYRSNVLFMNFFSVFVCTIGTLFLVFADVYVLASAFFQSKKEKETKFKHLHYQKRSCFFLANIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.18
4 0.17
5 0.14
6 0.14
7 0.13
8 0.13
9 0.12
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.04
28 0.05
29 0.05
30 0.07
31 0.12
32 0.13
33 0.18
34 0.26
35 0.32
36 0.41
37 0.48
38 0.57
39 0.62
40 0.66
41 0.72
42 0.74
43 0.79
44 0.79
45 0.82
46 0.8
47 0.78
48 0.77
49 0.68
50 0.62