Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P41546

Protein Details
Accession P41546    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-47AIPTNFKSTLPPRKRAKTKEEKEQRRIERILHydrophilic
NLS Segment(s)
PositionSequence
27-61PPRKRAKTKEEKEQRRIERILRNRRAAHQSREKKR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR044280  Hac1/HY5  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0030968  P:endoplasmic reticulum unfolded protein response  
GO:0010674  P:negative regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0034976  P:response to endoplasmic reticulum stress  
KEGG sce:YFL031W  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14710  bZIP_HAC1-like  
Amino Acid Sequences MEMTDFELTSNSQSNLAIPTNFKSTLPPRKRAKTKEEKEQRRIERILRNRRAAHQSREKKRLHLQYLERKCSLLENLLNSVNLEKLADHEDALTCSHDAFVASLDEYRDFQSTRGASLDTRASSHSSSDTFTPSPLNCTMEPATLSPKSMRDSASDQETSWELQMFKTENVPESTTLPAVDNNNLFDAVASPLADPLCDDIAGNSLPFDNSIDLDNWRNPEAQSGLNSFELNDFFITS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.2
4 0.19
5 0.18
6 0.21
7 0.24
8 0.25
9 0.24
10 0.27
11 0.35
12 0.44
13 0.49
14 0.56
15 0.61
16 0.7
17 0.8
18 0.81
19 0.83
20 0.83
21 0.84
22 0.85
23 0.87
24 0.87
25 0.86
26 0.88
27 0.84
28 0.81
29 0.77
30 0.74
31 0.73
32 0.73
33 0.75
34 0.73
35 0.74
36 0.7
37 0.72
38 0.75
39 0.72
40 0.71
41 0.71
42 0.72
43 0.74
44 0.8
45 0.75
46 0.71
47 0.74
48 0.74
49 0.69
50 0.67
51 0.67
52 0.68
53 0.76
54 0.74
55 0.66
56 0.56
57 0.5
58 0.43
59 0.35
60 0.3
61 0.23
62 0.2
63 0.22
64 0.22
65 0.22
66 0.19
67 0.18
68 0.13
69 0.1
70 0.08
71 0.06
72 0.06
73 0.1
74 0.1
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.11
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.11
104 0.13
105 0.15
106 0.1
107 0.11
108 0.11
109 0.12
110 0.12
111 0.13
112 0.12
113 0.1
114 0.11
115 0.11
116 0.13
117 0.12
118 0.12
119 0.14
120 0.12
121 0.15
122 0.16
123 0.18
124 0.15
125 0.18
126 0.19
127 0.17
128 0.18
129 0.15
130 0.18
131 0.16
132 0.17
133 0.15
134 0.16
135 0.18
136 0.19
137 0.19
138 0.18
139 0.22
140 0.23
141 0.27
142 0.25
143 0.23
144 0.22
145 0.22
146 0.19
147 0.16
148 0.16
149 0.11
150 0.1
151 0.13
152 0.13
153 0.13
154 0.16
155 0.16
156 0.17
157 0.19
158 0.2
159 0.18
160 0.19
161 0.19
162 0.16
163 0.16
164 0.14
165 0.14
166 0.15
167 0.17
168 0.16
169 0.16
170 0.16
171 0.16
172 0.15
173 0.12
174 0.11
175 0.09
176 0.09
177 0.08
178 0.08
179 0.09
180 0.09
181 0.09
182 0.08
183 0.09
184 0.09
185 0.09
186 0.09
187 0.07
188 0.1
189 0.11
190 0.11
191 0.09
192 0.08
193 0.08
194 0.09
195 0.1
196 0.09
197 0.09
198 0.11
199 0.12
200 0.14
201 0.19
202 0.22
203 0.23
204 0.24
205 0.25
206 0.23
207 0.27
208 0.26
209 0.25
210 0.25
211 0.25
212 0.26
213 0.26
214 0.26
215 0.22
216 0.22
217 0.19
218 0.17