Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P39715

Protein Details
Accession P39715    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-101LEAKISKKANKSKRGKKLNKKALEDKLHydrophilic
NLS Segment(s)
PositionSequence
78-95KISKKANKSKRGKKLNKK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG sce:YAL059W  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDEEIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.36
4 0.35
5 0.33
6 0.34
7 0.33
8 0.36
9 0.36
10 0.42
11 0.5
12 0.54
13 0.6
14 0.61
15 0.66
16 0.72
17 0.73
18 0.75
19 0.71
20 0.73
21 0.72
22 0.7
23 0.66
24 0.6
25 0.55
26 0.51
27 0.47
28 0.39
29 0.34
30 0.31
31 0.28
32 0.24
33 0.21
34 0.16
35 0.14
36 0.15
37 0.18
38 0.18
39 0.19
40 0.23
41 0.25
42 0.26
43 0.27
44 0.26
45 0.27
46 0.28
47 0.28
48 0.27
49 0.25
50 0.24
51 0.24
52 0.22
53 0.16
54 0.16
55 0.15
56 0.12
57 0.12
58 0.12
59 0.14
60 0.14
61 0.13
62 0.12
63 0.14
64 0.14
65 0.18
66 0.19
67 0.2
68 0.26
69 0.36
70 0.44
71 0.52
72 0.61
73 0.67
74 0.76
75 0.84
76 0.87
77 0.88
78 0.9
79 0.9
80 0.88
81 0.84
82 0.81
83 0.76
84 0.73
85 0.63
86 0.53
87 0.49
88 0.41
89 0.35
90 0.27
91 0.22
92 0.15
93 0.16
94 0.16
95 0.1
96 0.11
97 0.12
98 0.12
99 0.12
100 0.13
101 0.12
102 0.13
103 0.18
104 0.2
105 0.23
106 0.23
107 0.27
108 0.27
109 0.26
110 0.26
111 0.21
112 0.2
113 0.23
114 0.23
115 0.18
116 0.21
117 0.27
118 0.28
119 0.33
120 0.32
121 0.29
122 0.38
123 0.47
124 0.52
125 0.53
126 0.54
127 0.49
128 0.55
129 0.54
130 0.47
131 0.41
132 0.37
133 0.34
134 0.35
135 0.41
136 0.35
137 0.34
138 0.33
139 0.3
140 0.26
141 0.22
142 0.19
143 0.14
144 0.15
145 0.15
146 0.15
147 0.14
148 0.14
149 0.12
150 0.11
151 0.09
152 0.08
153 0.08
154 0.07
155 0.08
156 0.1
157 0.1
158 0.13
159 0.14
160 0.17
161 0.19
162 0.19
163 0.18
164 0.18
165 0.18
166 0.16
167 0.16
168 0.13
169 0.12
170 0.12
171 0.12
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.08
178 0.08
179 0.1
180 0.13
181 0.14
182 0.13
183 0.15
184 0.21
185 0.27
186 0.35
187 0.38
188 0.37
189 0.37
190 0.4
191 0.42
192 0.39