Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38300

Protein Details
Accession P38300   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-58LNKESETTKKKDKSKQQDFNPRHLGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024621  Mba1  
IPR012483  Mba1_Saccharomycetales  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0097177  F:mitochondrial ribosome binding  
GO:0043022  F:ribosome binding  
GO:0007007  P:inner mitochondrial membrane organization  
GO:0070131  P:positive regulation of mitochondrial translation  
GO:0032979  P:protein insertion into mitochondrial inner membrane from matrix  
KEGG sce:YBR185C  -  
Pfam View protein in Pfam  
PF07961  MBA1  
Amino Acid Sequences MSVLRSTCLFFPPRSLLISFNKRRLFSTSRLILNKESETTKKKDKSKQQDFNPRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRFQSGIKPSFLLWKNKAIETYINVNTSFAHKNLSDIKGLVSLWVQEALEARSRQLPGNATLDWQLIKFNAVPKLVSVQPIMIPGMPLEHLQLVYKFDTKQRLIKVNQQTKKTETLDRDVVDYIAFLCDATTNDMILMGSLFESKPNDKLPKSYEDDAKVAIHRMKVNGDIYRLPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.39
5 0.49
6 0.5
7 0.54
8 0.57
9 0.55
10 0.56
11 0.58
12 0.55
13 0.49
14 0.52
15 0.5
16 0.52
17 0.54
18 0.55
19 0.51
20 0.49
21 0.46
22 0.39
23 0.37
24 0.36
25 0.39
26 0.42
27 0.49
28 0.53
29 0.59
30 0.66
31 0.72
32 0.77
33 0.82
34 0.86
35 0.86
36 0.89
37 0.85
38 0.84
39 0.82
40 0.71
41 0.6
42 0.5
43 0.4
44 0.3
45 0.28
46 0.19
47 0.1
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.07
54 0.07
55 0.09
56 0.12
57 0.13
58 0.18
59 0.19
60 0.22
61 0.24
62 0.23
63 0.22
64 0.19
65 0.18
66 0.14
67 0.14
68 0.11
69 0.08
70 0.08
71 0.09
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.09
79 0.11
80 0.13
81 0.13
82 0.12
83 0.12
84 0.11
85 0.1
86 0.11
87 0.1
88 0.08
89 0.08
90 0.09
91 0.08
92 0.11
93 0.15
94 0.16
95 0.16
96 0.16
97 0.16
98 0.24
99 0.28
100 0.32
101 0.29
102 0.35
103 0.36
104 0.36
105 0.36
106 0.29
107 0.26
108 0.22
109 0.26
110 0.21
111 0.2
112 0.19
113 0.19
114 0.18
115 0.2
116 0.18
117 0.13
118 0.13
119 0.11
120 0.14
121 0.18
122 0.19
123 0.16
124 0.15
125 0.15
126 0.14
127 0.14
128 0.12
129 0.08
130 0.07
131 0.06
132 0.07
133 0.06
134 0.05
135 0.06
136 0.07
137 0.11
138 0.11
139 0.12
140 0.14
141 0.15
142 0.15
143 0.17
144 0.18
145 0.16
146 0.19
147 0.18
148 0.16
149 0.16
150 0.16
151 0.14
152 0.12
153 0.1
154 0.07
155 0.08
156 0.09
157 0.11
158 0.15
159 0.15
160 0.15
161 0.15
162 0.18
163 0.18
164 0.19
165 0.15
166 0.12
167 0.12
168 0.13
169 0.13
170 0.1
171 0.09
172 0.07
173 0.08
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.08
180 0.09
181 0.11
182 0.12
183 0.14
184 0.15
185 0.18
186 0.25
187 0.27
188 0.32
189 0.36
190 0.42
191 0.43
192 0.51
193 0.58
194 0.61
195 0.64
196 0.64
197 0.62
198 0.58
199 0.62
200 0.56
201 0.52
202 0.46
203 0.47
204 0.46
205 0.43
206 0.41
207 0.34
208 0.31
209 0.24
210 0.19
211 0.13
212 0.08
213 0.08
214 0.06
215 0.05
216 0.06
217 0.07
218 0.11
219 0.11
220 0.1
221 0.1
222 0.11
223 0.11
224 0.1
225 0.09
226 0.05
227 0.05
228 0.06
229 0.06
230 0.08
231 0.12
232 0.14
233 0.18
234 0.25
235 0.33
236 0.33
237 0.39
238 0.42
239 0.47
240 0.52
241 0.54
242 0.54
243 0.51
244 0.51
245 0.47
246 0.45
247 0.38
248 0.37
249 0.34
250 0.32
251 0.31
252 0.31
253 0.32
254 0.35
255 0.38
256 0.36
257 0.37
258 0.37