Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08559

Protein Details
Accession Q08559    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-47GKLGHPCPLSRRRKKHLREKEMGPQYBasic
NLS Segment(s)
PositionSequence
32-41RRRKKHLREK
Subcellular Location(s) mito 7.5, cyto_mito 7, cyto 5.5, nucl 5, pero 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG sce:YOR183W  -  
Amino Acid Sequences MRLLHHGEYGTKLIGGKCSIDGKLGHPCPLSRRRKKHLREKEMGPQYVRMYGPKRKAIIRTGNPDDGINLPDTGRGTLTAATIWSRAYHSNYSYLVRPKVVTLSKHRELMTTFLLYVLYVCIYISAFIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.18
5 0.2
6 0.2
7 0.2
8 0.21
9 0.2
10 0.29
11 0.3
12 0.3
13 0.28
14 0.29
15 0.35
16 0.44
17 0.52
18 0.53
19 0.61
20 0.67
21 0.76
22 0.85
23 0.88
24 0.89
25 0.88
26 0.84
27 0.81
28 0.81
29 0.79
30 0.72
31 0.62
32 0.54
33 0.45
34 0.41
35 0.36
36 0.29
37 0.26
38 0.3
39 0.35
40 0.36
41 0.38
42 0.37
43 0.41
44 0.44
45 0.48
46 0.47
47 0.49
48 0.48
49 0.47
50 0.45
51 0.4
52 0.34
53 0.25
54 0.2
55 0.13
56 0.09
57 0.07
58 0.08
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.11
74 0.14
75 0.17
76 0.18
77 0.21
78 0.22
79 0.24
80 0.27
81 0.3
82 0.28
83 0.27
84 0.26
85 0.23
86 0.29
87 0.31
88 0.32
89 0.36
90 0.43
91 0.46
92 0.51
93 0.5
94 0.45
95 0.42
96 0.41
97 0.35
98 0.28
99 0.24
100 0.19
101 0.19
102 0.16
103 0.15
104 0.11
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06