Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P53437

Protein Details
Accession P53437    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
254-283LYNDIPEKYKKRKFRLPKQILKKYHQPKKTHydrophilic
305-327LKDKRLTSKDKSKLQRLNREETEHydrophilic
NLS Segment(s)
PositionSequence
262-278YKKRKFRLPKQILKKYH
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019622  Rrn9_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0000500  C:RNA polymerase I upstream activating factor complex  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
GO:0017025  F:TBP-class protein binding  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
GO:0045943  P:positive regulation of transcription by RNA polymerase I  
KEGG sce:YMR270C  -  
Pfam View protein in Pfam  
PF10680  RRN9  
Amino Acid Sequences MSDLDEESQIETQIDAPIEDIIRGSELTTTTADKETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQFVKTQIKDNWTSWPNPNTIIDPSVDKLYEDIPEGIANVSVQPGEISNRALMHASDMMRVELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHDKIAKENEFDVRQDKHSNNIRANQIDDEPMQANRRIKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIPEKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFIPVEKLLKDKRLTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIELPNGNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.13
5 0.13
6 0.12
7 0.11
8 0.09
9 0.1
10 0.1
11 0.1
12 0.1
13 0.1
14 0.12
15 0.13
16 0.15
17 0.16
18 0.17
19 0.18
20 0.18
21 0.19
22 0.21
23 0.23
24 0.23
25 0.22
26 0.22
27 0.24
28 0.23
29 0.22
30 0.18
31 0.16
32 0.17
33 0.19
34 0.19
35 0.18
36 0.17
37 0.18
38 0.17
39 0.18
40 0.17
41 0.15
42 0.18
43 0.18
44 0.17
45 0.16
46 0.16
47 0.15
48 0.18
49 0.17
50 0.14
51 0.12
52 0.14
53 0.17
54 0.2
55 0.26
56 0.26
57 0.36
58 0.44
59 0.54
60 0.61
61 0.62
62 0.63
63 0.65
64 0.65
65 0.57
66 0.58
67 0.56
68 0.56
69 0.53
70 0.5
71 0.44
72 0.46
73 0.44
74 0.39
75 0.35
76 0.33
77 0.34
78 0.36
79 0.42
80 0.38
81 0.41
82 0.42
83 0.42
84 0.37
85 0.36
86 0.36
87 0.29
88 0.28
89 0.25
90 0.2
91 0.18
92 0.18
93 0.17
94 0.16
95 0.13
96 0.12
97 0.12
98 0.12
99 0.12
100 0.11
101 0.09
102 0.09
103 0.1
104 0.09
105 0.08
106 0.07
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.07
114 0.08
115 0.08
116 0.09
117 0.1
118 0.1
119 0.11
120 0.1
121 0.1
122 0.12
123 0.12
124 0.12
125 0.12
126 0.12
127 0.11
128 0.11
129 0.1
130 0.08
131 0.12
132 0.14
133 0.14
134 0.15
135 0.15
136 0.16
137 0.15
138 0.16
139 0.13
140 0.11
141 0.12
142 0.14
143 0.19
144 0.19
145 0.18
146 0.17
147 0.16
148 0.14
149 0.14
150 0.11
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.05
160 0.05
161 0.06
162 0.07
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.1
169 0.09
170 0.09
171 0.08
172 0.07
173 0.07
174 0.09
175 0.08
176 0.1
177 0.09
178 0.09
179 0.11
180 0.13
181 0.13
182 0.12
183 0.14
184 0.16
185 0.16
186 0.17
187 0.19
188 0.19
189 0.21
190 0.25
191 0.24
192 0.29
193 0.36
194 0.4
195 0.4
196 0.44
197 0.44
198 0.4
199 0.42
200 0.35
201 0.28
202 0.24
203 0.2
204 0.17
205 0.14
206 0.15
207 0.15
208 0.18
209 0.21
210 0.2
211 0.22
212 0.22
213 0.22
214 0.25
215 0.31
216 0.32
217 0.31
218 0.32
219 0.31
220 0.31
221 0.33
222 0.31
223 0.24
224 0.19
225 0.17
226 0.15
227 0.16
228 0.14
229 0.12
230 0.09
231 0.09
232 0.1
233 0.09
234 0.08
235 0.07
236 0.06
237 0.06
238 0.08
239 0.08
240 0.09
241 0.1
242 0.13
243 0.16
244 0.16
245 0.19
246 0.22
247 0.3
248 0.37
249 0.45
250 0.52
251 0.57
252 0.67
253 0.75
254 0.81
255 0.85
256 0.86
257 0.88
258 0.9
259 0.91
260 0.89
261 0.84
262 0.83
263 0.82
264 0.81
265 0.78
266 0.72
267 0.7
268 0.69
269 0.73
270 0.72
271 0.65
272 0.65
273 0.63
274 0.61
275 0.61
276 0.56
277 0.54
278 0.48
279 0.47
280 0.4
281 0.4
282 0.36
283 0.32
284 0.32
285 0.29
286 0.32
287 0.3
288 0.31
289 0.27
290 0.32
291 0.33
292 0.38
293 0.36
294 0.37
295 0.46
296 0.53
297 0.59
298 0.62
299 0.69
300 0.71
301 0.78
302 0.79
303 0.8
304 0.8
305 0.83
306 0.84
307 0.8
308 0.81
309 0.76
310 0.74
311 0.64
312 0.58
313 0.55
314 0.5
315 0.46
316 0.43
317 0.41
318 0.34
319 0.35
320 0.39
321 0.34
322 0.3
323 0.34
324 0.37
325 0.38
326 0.41
327 0.42
328 0.37
329 0.35
330 0.35
331 0.29
332 0.21
333 0.19
334 0.15
335 0.14
336 0.12
337 0.12
338 0.11
339 0.11
340 0.09
341 0.09
342 0.08
343 0.09
344 0.1
345 0.09