Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40169

Protein Details
Accession P40169   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
258-281QSHQNHRFFKKLRTKKRTVTSAGDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005938  C:cell cortex  
GO:0071944  C:cell periphery  
GO:0005737  C:cytoplasm  
GO:0005783  C:endoplasmic reticulum  
GO:0045121  C:membrane raft  
GO:0005886  C:plasma membrane  
GO:0030437  P:ascospore formation  
GO:0030866  P:cortical actin cytoskeleton organization  
GO:0006897  P:endocytosis  
GO:0031505  P:fungal-type cell wall organization  
GO:0032185  P:septin cytoskeleton organization  
KEGG sce:YNL194C  -  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MSYKKFVYFINLFFLLGATLLTFFLILAGGRTTGVLKNFYWFQASTSGFNSAPSVTRWYNYNWCGWESRGIAVNCSSKMAAQPFSPRDNFGSSPLMPSTFLNNRNAYYYLSRVGWAMLLIGLFFLLITLVSVIASLIRYNRRTAALATAMSWITLFFITLSACLYTGCYAKAVKAFHHENRDARLGPKNFGLIWTTVFLLIVNAICCTIMVATHKRNEYIYDRSFASTKTVDSQTPTPVPTNGGIPSSVPVTEVQQSQSHQNHRFFKKLRTKKRTVTSAGDEPDRVQEERVYTEQNVPVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.14
4 0.12
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.09
20 0.11
21 0.14
22 0.15
23 0.15
24 0.19
25 0.21
26 0.21
27 0.23
28 0.2
29 0.2
30 0.24
31 0.26
32 0.24
33 0.24
34 0.27
35 0.23
36 0.24
37 0.23
38 0.17
39 0.16
40 0.16
41 0.2
42 0.18
43 0.19
44 0.2
45 0.24
46 0.31
47 0.32
48 0.35
49 0.31
50 0.32
51 0.33
52 0.32
53 0.33
54 0.26
55 0.27
56 0.29
57 0.27
58 0.26
59 0.28
60 0.3
61 0.24
62 0.24
63 0.22
64 0.15
65 0.19
66 0.2
67 0.19
68 0.18
69 0.25
70 0.27
71 0.32
72 0.33
73 0.31
74 0.3
75 0.33
76 0.32
77 0.27
78 0.28
79 0.23
80 0.24
81 0.23
82 0.21
83 0.18
84 0.17
85 0.2
86 0.21
87 0.24
88 0.26
89 0.27
90 0.27
91 0.29
92 0.3
93 0.26
94 0.22
95 0.21
96 0.18
97 0.17
98 0.17
99 0.14
100 0.13
101 0.11
102 0.09
103 0.07
104 0.05
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.03
122 0.04
123 0.06
124 0.11
125 0.12
126 0.13
127 0.15
128 0.16
129 0.17
130 0.18
131 0.18
132 0.15
133 0.14
134 0.14
135 0.14
136 0.12
137 0.11
138 0.1
139 0.07
140 0.06
141 0.05
142 0.05
143 0.03
144 0.04
145 0.04
146 0.04
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.08
158 0.12
159 0.13
160 0.13
161 0.19
162 0.24
163 0.27
164 0.34
165 0.37
166 0.35
167 0.38
168 0.4
169 0.35
170 0.32
171 0.36
172 0.31
173 0.29
174 0.28
175 0.25
176 0.22
177 0.22
178 0.2
179 0.13
180 0.12
181 0.12
182 0.11
183 0.09
184 0.09
185 0.08
186 0.07
187 0.06
188 0.06
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.09
198 0.15
199 0.19
200 0.24
201 0.25
202 0.26
203 0.27
204 0.3
205 0.31
206 0.34
207 0.32
208 0.3
209 0.3
210 0.31
211 0.31
212 0.27
213 0.26
214 0.19
215 0.18
216 0.21
217 0.22
218 0.21
219 0.24
220 0.26
221 0.27
222 0.29
223 0.29
224 0.26
225 0.24
226 0.25
227 0.22
228 0.23
229 0.18
230 0.17
231 0.15
232 0.14
233 0.15
234 0.13
235 0.12
236 0.11
237 0.1
238 0.12
239 0.15
240 0.16
241 0.18
242 0.2
243 0.21
244 0.29
245 0.35
246 0.41
247 0.46
248 0.52
249 0.59
250 0.61
251 0.69
252 0.65
253 0.69
254 0.71
255 0.75
256 0.78
257 0.78
258 0.82
259 0.83
260 0.88
261 0.87
262 0.82
263 0.79
264 0.75
265 0.73
266 0.69
267 0.62
268 0.53
269 0.45
270 0.44
271 0.4
272 0.33
273 0.27
274 0.26
275 0.26
276 0.3
277 0.32
278 0.3
279 0.29
280 0.34
281 0.35