Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P22134

Protein Details
Accession P22134   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
228-255KELMRERKVVKKSKIKHKKYNWKIYDDDBasic
NLS Segment(s)
PositionSequence
232-246RERKVVKKSKIKHKK
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000035  Alkylbase_DNA_glycsylse_CS  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0032993  C:protein-DNA complex  
GO:0032131  F:alkylated DNA binding  
GO:0003905  F:alkylbase DNA N-glycosylase activity  
GO:0003684  F:damaged DNA binding  
GO:0008725  F:DNA-3-methyladenine glycosylase activity  
GO:0052822  F:DNA-3-methylguanine glycosylase activity  
GO:0052821  F:DNA-7-methyladenine glycosylase activity  
GO:0043916  F:DNA-7-methylguanine glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
GO:0006307  P:DNA dealkylation involved in DNA repair  
KEGG sce:YER142C  -  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
PROSITE View protein in PROSITE  
PS00516  ALKYLBASE_DNA_GLYCOS  
CDD cd00056  ENDO3c  
Amino Acid Sequences MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEHILEKDPSLFPILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQAAESIKARVVSLYGGAFPDYKILFEDFKDPAKCAEIAKCGLSKRKMIYLESLAVYFTEKYKDIEKLFGQKDNDEEVIESLVTNVKGIGPWSAKMFLISGLKRMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKSKIKHKKYNWKIYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.17
4 0.16
5 0.15
6 0.15
7 0.15
8 0.16
9 0.15
10 0.23
11 0.23
12 0.23
13 0.22
14 0.23
15 0.23
16 0.22
17 0.24
18 0.17
19 0.18
20 0.18
21 0.19
22 0.18
23 0.2
24 0.24
25 0.27
26 0.31
27 0.33
28 0.38
29 0.42
30 0.43
31 0.42
32 0.4
33 0.34
34 0.29
35 0.27
36 0.24
37 0.2
38 0.21
39 0.18
40 0.16
41 0.19
42 0.19
43 0.18
44 0.19
45 0.19
46 0.17
47 0.25
48 0.3
49 0.3
50 0.32
51 0.32
52 0.31
53 0.31
54 0.32
55 0.28
56 0.27
57 0.25
58 0.23
59 0.26
60 0.25
61 0.26
62 0.31
63 0.27
64 0.24
65 0.25
66 0.24
67 0.21
68 0.2
69 0.22
70 0.16
71 0.15
72 0.13
73 0.1
74 0.1
75 0.1
76 0.11
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.12
83 0.12
84 0.11
85 0.1
86 0.1
87 0.09
88 0.1
89 0.11
90 0.09
91 0.09
92 0.09
93 0.09
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.07
104 0.09
105 0.08
106 0.08
107 0.09
108 0.1
109 0.1
110 0.1
111 0.14
112 0.13
113 0.18
114 0.18
115 0.18
116 0.17
117 0.18
118 0.18
119 0.16
120 0.17
121 0.16
122 0.16
123 0.17
124 0.19
125 0.19
126 0.24
127 0.25
128 0.25
129 0.24
130 0.28
131 0.28
132 0.27
133 0.28
134 0.25
135 0.24
136 0.21
137 0.2
138 0.14
139 0.13
140 0.12
141 0.09
142 0.08
143 0.07
144 0.08
145 0.09
146 0.11
147 0.15
148 0.16
149 0.19
150 0.2
151 0.27
152 0.28
153 0.31
154 0.3
155 0.26
156 0.27
157 0.26
158 0.25
159 0.17
160 0.15
161 0.11
162 0.1
163 0.1
164 0.08
165 0.05
166 0.07
167 0.06
168 0.06
169 0.06
170 0.05
171 0.06
172 0.06
173 0.1
174 0.09
175 0.1
176 0.12
177 0.13
178 0.13
179 0.13
180 0.13
181 0.12
182 0.16
183 0.16
184 0.18
185 0.18
186 0.18
187 0.18
188 0.18
189 0.17
190 0.13
191 0.15
192 0.11
193 0.12
194 0.12
195 0.12
196 0.11
197 0.11
198 0.09
199 0.07
200 0.07
201 0.06
202 0.06
203 0.06
204 0.09
205 0.11
206 0.16
207 0.21
208 0.24
209 0.26
210 0.31
211 0.38
212 0.37
213 0.36
214 0.35
215 0.33
216 0.4
217 0.44
218 0.41
219 0.39
220 0.41
221 0.48
222 0.55
223 0.6
224 0.6
225 0.64
226 0.72
227 0.79
228 0.85
229 0.86
230 0.88
231 0.89
232 0.91
233 0.92
234 0.93
235 0.88
236 0.83
237 0.76
238 0.7
239 0.67
240 0.58
241 0.54
242 0.44
243 0.4
244 0.34
245 0.31
246 0.27
247 0.2
248 0.18
249 0.16
250 0.18
251 0.18
252 0.25
253 0.26
254 0.28
255 0.28
256 0.31
257 0.27
258 0.26
259 0.29
260 0.22
261 0.27
262 0.24
263 0.23
264 0.2
265 0.22
266 0.21
267 0.19
268 0.21
269 0.16
270 0.18
271 0.18
272 0.17
273 0.19
274 0.18
275 0.15
276 0.19