Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q05900

Protein Details
Accession Q05900    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-70RDIINKHNHKRRHIGKRGRKERENSSQNBasic
NLS Segment(s)
PositionSequence
47-64NKHNHKRRHIGKRGRKER
Subcellular Location(s) nucl 21, mito_nucl 13.499, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR017340  U1_snRNP-C  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0000243  C:commitment complex  
GO:0005634  C:nucleus  
GO:0005681  C:spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0003729  F:mRNA binding  
GO:0030627  F:pre-mRNA 5'-splice site binding  
GO:0030619  F:U1 snRNA binding  
GO:0008270  F:zinc ion binding  
GO:0000395  P:mRNA 5'-splice site recognition  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:1905216  P:positive regulation of RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
KEGG sce:YLR298C  -  
Pfam View protein in Pfam  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50171  ZF_MATRIN  
Amino Acid Sequences MTRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQTSRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVDILQTTIKESKKRMHSDGIRKPSSANGYKRRRYGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.29
4 0.28
5 0.3
6 0.28
7 0.26
8 0.25
9 0.25
10 0.32
11 0.38
12 0.4
13 0.46
14 0.53
15 0.59
16 0.58
17 0.58
18 0.52
19 0.45
20 0.47
21 0.48
22 0.46
23 0.41
24 0.45
25 0.51
26 0.5
27 0.5
28 0.47
29 0.44
30 0.45
31 0.5
32 0.56
33 0.58
34 0.68
35 0.76
36 0.8
37 0.8
38 0.77
39 0.78
40 0.78
41 0.79
42 0.79
43 0.81
44 0.83
45 0.87
46 0.92
47 0.91
48 0.88
49 0.82
50 0.81
51 0.81
52 0.78
53 0.7
54 0.67
55 0.64
56 0.57
57 0.54
58 0.46
59 0.35
60 0.3
61 0.27
62 0.21
63 0.17
64 0.22
65 0.26
66 0.34
67 0.38
68 0.41
69 0.46
70 0.46
71 0.52
72 0.57
73 0.55
74 0.57
75 0.6
76 0.64
77 0.67
78 0.7
79 0.65
80 0.59
81 0.54
82 0.5
83 0.45
84 0.38
85 0.3
86 0.26
87 0.23
88 0.2
89 0.19
90 0.13
91 0.1
92 0.07
93 0.07
94 0.07
95 0.05
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.1
106 0.1
107 0.14
108 0.14
109 0.16
110 0.16
111 0.16
112 0.15
113 0.14
114 0.13
115 0.1
116 0.1
117 0.08
118 0.08
119 0.08
120 0.09
121 0.11
122 0.16
123 0.16
124 0.23
125 0.32
126 0.35
127 0.39
128 0.43
129 0.43
130 0.46
131 0.51
132 0.49
133 0.41
134 0.42
135 0.42
136 0.43
137 0.49
138 0.49
139 0.47
140 0.49
141 0.54
142 0.51
143 0.53
144 0.49
145 0.44
146 0.41
147 0.44
148 0.39
149 0.36
150 0.37
151 0.34
152 0.33
153 0.38
154 0.44
155 0.44
156 0.53
157 0.54
158 0.58
159 0.67
160 0.73
161 0.72
162 0.68
163 0.66
164 0.64
165 0.65
166 0.62
167 0.54
168 0.5
169 0.48
170 0.47
171 0.48
172 0.4
173 0.37
174 0.34
175 0.33
176 0.33
177 0.28
178 0.29
179 0.24
180 0.25
181 0.25
182 0.26
183 0.26
184 0.22
185 0.22
186 0.16
187 0.15
188 0.18
189 0.21
190 0.23
191 0.26
192 0.3
193 0.38
194 0.47
195 0.53
196 0.55
197 0.59
198 0.65
199 0.71
200 0.78
201 0.79
202 0.72
203 0.65
204 0.61
205 0.58
206 0.57
207 0.55
208 0.55
209 0.55
210 0.63
211 0.7