Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40314

Protein Details
Accession P40314   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ANKVGGTRRKINKKGNLYNNNDKDNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto_nucl 8.833, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0030015  C:CCR4-NOT core complex  
GO:0005829  C:cytosol  
GO:0005854  C:nascent polypeptide-associated complex  
GO:0005634  C:nucleus  
GO:0042788  C:polysomal ribosome  
GO:0051082  F:unfolded protein binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0006620  P:post-translational protein targeting to endoplasmic reticulum membrane  
KEGG sce:YDR252W  -  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MPVDQEKLAKLHKLSAANKVGGTRRKINKKGNLYNNNDKDNTKLQAELHKLHPMTIENVAEANFFKKNGKVLHFNSAVVQIAPQCNLTMIHGQPKENTLNGLYPSVASQLGSQELEYLTGLAHNLENEQTVLDQLGDRCSETKQQVMNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.48
4 0.45
5 0.45
6 0.43
7 0.45
8 0.43
9 0.46
10 0.46
11 0.51
12 0.6
13 0.68
14 0.73
15 0.76
16 0.8
17 0.84
18 0.85
19 0.85
20 0.83
21 0.85
22 0.81
23 0.76
24 0.68
25 0.58
26 0.52
27 0.46
28 0.41
29 0.31
30 0.27
31 0.24
32 0.29
33 0.33
34 0.32
35 0.3
36 0.32
37 0.31
38 0.3
39 0.3
40 0.24
41 0.21
42 0.21
43 0.18
44 0.13
45 0.13
46 0.13
47 0.11
48 0.1
49 0.1
50 0.07
51 0.08
52 0.09
53 0.09
54 0.14
55 0.17
56 0.2
57 0.25
58 0.27
59 0.33
60 0.33
61 0.32
62 0.29
63 0.26
64 0.23
65 0.16
66 0.14
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.07
74 0.09
75 0.11
76 0.11
77 0.18
78 0.19
79 0.2
80 0.2
81 0.23
82 0.23
83 0.2
84 0.2
85 0.14
86 0.15
87 0.16
88 0.16
89 0.12
90 0.11
91 0.11
92 0.11
93 0.1
94 0.08
95 0.07
96 0.08
97 0.1
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.06
111 0.07
112 0.08
113 0.08
114 0.08
115 0.09
116 0.08
117 0.08
118 0.08
119 0.08
120 0.09
121 0.1
122 0.12
123 0.13
124 0.14
125 0.15
126 0.17
127 0.24
128 0.25
129 0.3