Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38274

Protein Details
Accession P38274   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-29GVKPGFNHKQHSKKSRFLENVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025799  Arg_MeTrfase  
IPR007857  Arg_MeTrfase_PRMT5  
IPR035075  PRMT5  
IPR035248  PRMT5_C  
IPR035247  PRMT5_TIM  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0032174  C:cellular bud neck septin collar  
GO:0000144  C:cellular bud neck septin ring  
GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0005824  C:outer plaque of spindle pole body  
GO:0008469  F:histone arginine N-methyltransferase activity  
GO:0042054  F:histone methyltransferase activity  
GO:0035241  F:protein-arginine omega-N monomethyltransferase activity  
GO:0035243  F:protein-arginine omega-N symmetric methyltransferase activity  
GO:0051301  P:cell division  
GO:0000902  P:cell morphogenesis  
GO:0000086  P:G2/M transition of mitotic cell cycle  
GO:0034969  P:histone arginine methylation  
GO:0035246  P:peptidyl-arginine N-methylation  
GO:0045840  P:positive regulation of mitotic nuclear division  
GO:0030163  P:protein catabolic process  
GO:0051726  P:regulation of cell cycle  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG sce:YBR133C  -  
Pfam View protein in Pfam  
PF05185  PRMT5  
PF17286  PRMT5_C  
PF17285  PRMT5_TIM  
PROSITE View protein in PROSITE  
PS51678  SAM_MT_PRMT  
Amino Acid Sequences MHSNVFVGVKPGFNHKQHSKKSRFLENVSSHSPELPSNYDYVLLPITTPRYKEIVGQVFKDFQRQSIQNWKPLQIPEPQLQDICIPPFNVKKLDNDDTPSYIGLLSSWLELESRDPNVRDLGLKVLLNECKYARFVGINKLILAPPRDLSNLQLYGQMIYRLLQNRIVFAAPALTISISLPLYEDSDPLATWELWNTVRKQCEYHPSLTISLALPRTRTPSYVLNRWLAEPVSCLLVSSSIFASNQYDYPVLHKFNQNLILKFQKVNGDSQILGNELCVILHGMEKYANNVKGGESAYLEYINYLLKKGDKVLNSNSNHQFLLQEDSRIMPPLKPHSDNLLNSTYLTFEKDLVKYDLYESAILEALQDLAPRASAKRPLVILVAGAGRGPLVDRTFKIISMLFMDSKVSIIAIEKNPQAYLYLQKRNFDCWDNRVKLIKEDMTKWQINEPSEKRIQIDLCISELLGSFGCNELSPECLWSIEKYHSHNDTIFIPRSYSSYIAPISSPLFYQKLSQTNRSLEAPWIVHRVPYCILSSRVNEVWRFEHPMAQKDTVQDEDDFTVEFSQSSLNEFKIKHRGEIHGFIGFFSANLYNNIFLSTLPNDSTVRLKFSEETLMNTRREENLIKKCDHTPNMTSWSPIIFPLKQPISFIDDSELSVLMSRIHSDTEQKVWYEWSLESFIYLMLSNYTSAVTAASMTIPRSIVTDDTKTLAHNRHYSATTNQKLDNQIDLDQDIENEEEQGFLSNLETGWQSVQDIHGLSETAKPDHLDSINKPMFDLKSTKALEPSNELPRHEDLEEDVPEVHVRVKTSVSTLHNVCGRAFSLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.6
4 0.68
5 0.78
6 0.77
7 0.78
8 0.81
9 0.83
10 0.8
11 0.76
12 0.76
13 0.71
14 0.7
15 0.66
16 0.62
17 0.52
18 0.47
19 0.42
20 0.33
21 0.31
22 0.28
23 0.25
24 0.22
25 0.22
26 0.22
27 0.2
28 0.2
29 0.17
30 0.13
31 0.12
32 0.14
33 0.2
34 0.22
35 0.23
36 0.25
37 0.27
38 0.28
39 0.32
40 0.38
41 0.42
42 0.43
43 0.44
44 0.44
45 0.47
46 0.47
47 0.5
48 0.41
49 0.34
50 0.39
51 0.38
52 0.41
53 0.46
54 0.51
55 0.51
56 0.54
57 0.54
58 0.51
59 0.52
60 0.49
61 0.45
62 0.46
63 0.44
64 0.46
65 0.45
66 0.4
67 0.38
68 0.37
69 0.32
70 0.29
71 0.25
72 0.2
73 0.23
74 0.28
75 0.31
76 0.34
77 0.33
78 0.36
79 0.42
80 0.47
81 0.46
82 0.47
83 0.46
84 0.43
85 0.42
86 0.35
87 0.28
88 0.22
89 0.18
90 0.12
91 0.11
92 0.09
93 0.08
94 0.08
95 0.07
96 0.08
97 0.08
98 0.11
99 0.13
100 0.16
101 0.2
102 0.21
103 0.23
104 0.25
105 0.26
106 0.24
107 0.22
108 0.22
109 0.21
110 0.21
111 0.2
112 0.24
113 0.26
114 0.26
115 0.27
116 0.24
117 0.22
118 0.24
119 0.23
120 0.2
121 0.21
122 0.22
123 0.29
124 0.35
125 0.34
126 0.33
127 0.34
128 0.33
129 0.33
130 0.32
131 0.25
132 0.19
133 0.2
134 0.22
135 0.2
136 0.22
137 0.25
138 0.24
139 0.23
140 0.25
141 0.23
142 0.21
143 0.22
144 0.2
145 0.13
146 0.12
147 0.17
148 0.18
149 0.19
150 0.23
151 0.23
152 0.23
153 0.25
154 0.24
155 0.19
156 0.15
157 0.15
158 0.09
159 0.09
160 0.08
161 0.07
162 0.07
163 0.07
164 0.09
165 0.07
166 0.07
167 0.08
168 0.08
169 0.1
170 0.1
171 0.11
172 0.09
173 0.1
174 0.1
175 0.1
176 0.12
177 0.1
178 0.09
179 0.1
180 0.12
181 0.14
182 0.18
183 0.21
184 0.24
185 0.28
186 0.3
187 0.32
188 0.34
189 0.41
190 0.42
191 0.42
192 0.4
193 0.39
194 0.38
195 0.36
196 0.32
197 0.23
198 0.22
199 0.22
200 0.19
201 0.18
202 0.18
203 0.23
204 0.22
205 0.23
206 0.23
207 0.28
208 0.33
209 0.39
210 0.42
211 0.4
212 0.4
213 0.4
214 0.38
215 0.3
216 0.24
217 0.18
218 0.15
219 0.13
220 0.12
221 0.11
222 0.09
223 0.1
224 0.1
225 0.09
226 0.09
227 0.08
228 0.08
229 0.09
230 0.11
231 0.11
232 0.11
233 0.12
234 0.12
235 0.11
236 0.14
237 0.18
238 0.19
239 0.21
240 0.24
241 0.25
242 0.28
243 0.37
244 0.38
245 0.34
246 0.36
247 0.38
248 0.36
249 0.35
250 0.33
251 0.31
252 0.28
253 0.29
254 0.27
255 0.24
256 0.22
257 0.22
258 0.2
259 0.15
260 0.14
261 0.11
262 0.09
263 0.06
264 0.06
265 0.05
266 0.05
267 0.04
268 0.06
269 0.06
270 0.06
271 0.08
272 0.08
273 0.12
274 0.17
275 0.18
276 0.17
277 0.18
278 0.17
279 0.18
280 0.19
281 0.16
282 0.12
283 0.11
284 0.11
285 0.11
286 0.1
287 0.08
288 0.07
289 0.08
290 0.07
291 0.07
292 0.08
293 0.09
294 0.1
295 0.13
296 0.18
297 0.18
298 0.22
299 0.28
300 0.36
301 0.37
302 0.44
303 0.44
304 0.41
305 0.39
306 0.35
307 0.29
308 0.21
309 0.25
310 0.18
311 0.15
312 0.13
313 0.15
314 0.15
315 0.17
316 0.17
317 0.11
318 0.15
319 0.22
320 0.26
321 0.27
322 0.28
323 0.32
324 0.37
325 0.36
326 0.37
327 0.32
328 0.27
329 0.25
330 0.24
331 0.19
332 0.13
333 0.14
334 0.1
335 0.1
336 0.13
337 0.13
338 0.15
339 0.16
340 0.16
341 0.15
342 0.15
343 0.16
344 0.14
345 0.13
346 0.11
347 0.1
348 0.09
349 0.09
350 0.08
351 0.05
352 0.05
353 0.05
354 0.05
355 0.05
356 0.04
357 0.05
358 0.05
359 0.07
360 0.08
361 0.14
362 0.14
363 0.16
364 0.17
365 0.17
366 0.18
367 0.17
368 0.14
369 0.1
370 0.09
371 0.07
372 0.06
373 0.05
374 0.04
375 0.04
376 0.04
377 0.05
378 0.06
379 0.07
380 0.08
381 0.13
382 0.14
383 0.14
384 0.15
385 0.13
386 0.13
387 0.14
388 0.14
389 0.1
390 0.09
391 0.1
392 0.08
393 0.08
394 0.08
395 0.05
396 0.04
397 0.05
398 0.08
399 0.09
400 0.12
401 0.12
402 0.13
403 0.13
404 0.13
405 0.13
406 0.1
407 0.17
408 0.21
409 0.29
410 0.3
411 0.33
412 0.34
413 0.37
414 0.38
415 0.35
416 0.31
417 0.28
418 0.36
419 0.34
420 0.36
421 0.37
422 0.35
423 0.33
424 0.34
425 0.32
426 0.26
427 0.26
428 0.29
429 0.3
430 0.31
431 0.3
432 0.3
433 0.29
434 0.28
435 0.34
436 0.3
437 0.3
438 0.32
439 0.32
440 0.29
441 0.29
442 0.28
443 0.22
444 0.22
445 0.17
446 0.15
447 0.15
448 0.13
449 0.1
450 0.1
451 0.08
452 0.06
453 0.05
454 0.05
455 0.05
456 0.05
457 0.05
458 0.05
459 0.05
460 0.07
461 0.07
462 0.07
463 0.07
464 0.08
465 0.08
466 0.08
467 0.11
468 0.13
469 0.16
470 0.18
471 0.23
472 0.25
473 0.26
474 0.26
475 0.25
476 0.24
477 0.26
478 0.25
479 0.2
480 0.19
481 0.18
482 0.19
483 0.19
484 0.17
485 0.12
486 0.13
487 0.13
488 0.13
489 0.13
490 0.12
491 0.12
492 0.11
493 0.11
494 0.1
495 0.11
496 0.11
497 0.13
498 0.16
499 0.24
500 0.27
501 0.32
502 0.34
503 0.35
504 0.37
505 0.36
506 0.33
507 0.25
508 0.25
509 0.21
510 0.19
511 0.21
512 0.19
513 0.19
514 0.18
515 0.19
516 0.17
517 0.18
518 0.17
519 0.15
520 0.18
521 0.19
522 0.21
523 0.22
524 0.24
525 0.25
526 0.24
527 0.24
528 0.24
529 0.23
530 0.28
531 0.24
532 0.27
533 0.27
534 0.32
535 0.34
536 0.34
537 0.33
538 0.29
539 0.31
540 0.27
541 0.26
542 0.2
543 0.17
544 0.16
545 0.15
546 0.13
547 0.11
548 0.09
549 0.08
550 0.07
551 0.06
552 0.07
553 0.06
554 0.09
555 0.11
556 0.11
557 0.15
558 0.16
559 0.21
560 0.29
561 0.3
562 0.32
563 0.34
564 0.38
565 0.39
566 0.43
567 0.4
568 0.34
569 0.33
570 0.28
571 0.25
572 0.19
573 0.14
574 0.11
575 0.1
576 0.08
577 0.09
578 0.1
579 0.1
580 0.1
581 0.11
582 0.1
583 0.09
584 0.11
585 0.11
586 0.12
587 0.12
588 0.14
589 0.14
590 0.15
591 0.2
592 0.18
593 0.19
594 0.19
595 0.2
596 0.19
597 0.2
598 0.27
599 0.22
600 0.26
601 0.3
602 0.34
603 0.33
604 0.34
605 0.34
606 0.28
607 0.31
608 0.31
609 0.33
610 0.37
611 0.41
612 0.42
613 0.43
614 0.48
615 0.53
616 0.52
617 0.48
618 0.42
619 0.42
620 0.47
621 0.44
622 0.39
623 0.31
624 0.29
625 0.24
626 0.23
627 0.22
628 0.17
629 0.18
630 0.26
631 0.28
632 0.27
633 0.28
634 0.27
635 0.3
636 0.29
637 0.28
638 0.23
639 0.2
640 0.2
641 0.2
642 0.18
643 0.1
644 0.1
645 0.1
646 0.08
647 0.08
648 0.09
649 0.09
650 0.1
651 0.12
652 0.16
653 0.18
654 0.22
655 0.24
656 0.23
657 0.23
658 0.23
659 0.23
660 0.21
661 0.18
662 0.16
663 0.16
664 0.15
665 0.15
666 0.13
667 0.12
668 0.11
669 0.11
670 0.08
671 0.07
672 0.08
673 0.08
674 0.08
675 0.08
676 0.07
677 0.07
678 0.07
679 0.06
680 0.06
681 0.06
682 0.07
683 0.08
684 0.09
685 0.11
686 0.11
687 0.11
688 0.12
689 0.13
690 0.14
691 0.18
692 0.2
693 0.2
694 0.21
695 0.22
696 0.22
697 0.27
698 0.3
699 0.32
700 0.34
701 0.36
702 0.39
703 0.41
704 0.43
705 0.45
706 0.49
707 0.49
708 0.47
709 0.46
710 0.46
711 0.49
712 0.47
713 0.44
714 0.36
715 0.32
716 0.3
717 0.28
718 0.24
719 0.19
720 0.18
721 0.14
722 0.13
723 0.11
724 0.1
725 0.09
726 0.08
727 0.08
728 0.1
729 0.09
730 0.08
731 0.08
732 0.08
733 0.08
734 0.09
735 0.09
736 0.09
737 0.09
738 0.1
739 0.1
740 0.1
741 0.11
742 0.12
743 0.13
744 0.12
745 0.12
746 0.12
747 0.13
748 0.17
749 0.18
750 0.17
751 0.18
752 0.18
753 0.19
754 0.24
755 0.26
756 0.27
757 0.28
758 0.37
759 0.39
760 0.38
761 0.37
762 0.37
763 0.35
764 0.33
765 0.35
766 0.27
767 0.34
768 0.36
769 0.38
770 0.39
771 0.4
772 0.39
773 0.41
774 0.44
775 0.45
776 0.46
777 0.45
778 0.44
779 0.44
780 0.45
781 0.38
782 0.33
783 0.27
784 0.29
785 0.29
786 0.26
787 0.23
788 0.2
789 0.2
790 0.2
791 0.2
792 0.16
793 0.17
794 0.18
795 0.2
796 0.2
797 0.22
798 0.29
799 0.29
800 0.34
801 0.34
802 0.38
803 0.4
804 0.4
805 0.37
806 0.33
807 0.3