Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q99326

Protein Details
Accession Q99326   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
165-189NSEALPKRRRYDRKIKRRSRELYEDBasic
NLS Segment(s)
PositionSequence
151-161NKENRKLKVVK
167-184EALPKRRRYDRKIKRRSR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:1990483  C:Clr6 histone deacetylase complex I''  
GO:0005634  C:nucleus  
GO:0070210  C:Rpd3L-Expanded complex  
GO:0003682  F:chromatin binding  
GO:0003713  F:transcription coactivator activity  
GO:0030437  P:ascospore formation  
GO:0006338  P:chromatin remodeling  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG sce:YOR338W  -  
Pfam View protein in Pfam  
PF04433  SWIRM  
PROSITE View protein in PROSITE  
PS50934  SWIRM  
Amino Acid Sequences MLDNMQFHSPAPEHPQLNGGINKIPASHKIGYKLNQQVQRLAVVRNNIEERLNSMESSHGQISDSSVVRAIDASIDDFLIPSPPLSPKLRQCPIISQPQLVNVESDHRELIMLTPVWEAGLNSQKYNHNTRNFLSQYSFFRDMKTTKRIPNKENRKLKVVKSVVNSEALPKRRRYDRKIKRRSRELYEDDGNRSENYDEESAQEVPVRSVTPIRQVKRSLHTISSPLASQGVVNNVPKYIPSMSWEKLPDYSPPLHTLPNSNNKVLKVEWKGSPMDLNHDPLKQRLHPAELVLAQILRLPCDLYLDSKRRFFLEKVHRFKKGLPFRRTDAQKACRIDVNKASRLFAAFEKVGWLQDKHFEKYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.33
4 0.39
5 0.38
6 0.32
7 0.28
8 0.28
9 0.28
10 0.27
11 0.27
12 0.25
13 0.29
14 0.32
15 0.32
16 0.37
17 0.43
18 0.45
19 0.52
20 0.57
21 0.58
22 0.6
23 0.58
24 0.56
25 0.51
26 0.52
27 0.46
28 0.39
29 0.35
30 0.33
31 0.33
32 0.34
33 0.35
34 0.3
35 0.29
36 0.27
37 0.26
38 0.28
39 0.27
40 0.22
41 0.2
42 0.21
43 0.21
44 0.25
45 0.23
46 0.16
47 0.16
48 0.16
49 0.18
50 0.2
51 0.2
52 0.15
53 0.16
54 0.16
55 0.15
56 0.15
57 0.13
58 0.08
59 0.08
60 0.09
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.08
67 0.07
68 0.06
69 0.08
70 0.1
71 0.15
72 0.19
73 0.25
74 0.32
75 0.41
76 0.46
77 0.48
78 0.49
79 0.52
80 0.53
81 0.58
82 0.51
83 0.45
84 0.41
85 0.42
86 0.42
87 0.34
88 0.29
89 0.19
90 0.22
91 0.21
92 0.21
93 0.15
94 0.13
95 0.13
96 0.13
97 0.13
98 0.12
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.09
106 0.09
107 0.16
108 0.16
109 0.16
110 0.2
111 0.25
112 0.29
113 0.37
114 0.41
115 0.38
116 0.41
117 0.42
118 0.48
119 0.44
120 0.42
121 0.37
122 0.32
123 0.31
124 0.34
125 0.38
126 0.29
127 0.29
128 0.31
129 0.31
130 0.34
131 0.38
132 0.37
133 0.39
134 0.49
135 0.54
136 0.58
137 0.66
138 0.71
139 0.73
140 0.77
141 0.73
142 0.71
143 0.7
144 0.66
145 0.65
146 0.58
147 0.52
148 0.46
149 0.47
150 0.4
151 0.36
152 0.34
153 0.28
154 0.3
155 0.31
156 0.31
157 0.3
158 0.33
159 0.41
160 0.49
161 0.53
162 0.59
163 0.64
164 0.71
165 0.8
166 0.85
167 0.85
168 0.87
169 0.85
170 0.8
171 0.79
172 0.72
173 0.67
174 0.63
175 0.56
176 0.48
177 0.42
178 0.36
179 0.27
180 0.23
181 0.17
182 0.11
183 0.12
184 0.11
185 0.1
186 0.1
187 0.13
188 0.12
189 0.12
190 0.13
191 0.11
192 0.1
193 0.1
194 0.09
195 0.08
196 0.1
197 0.11
198 0.19
199 0.26
200 0.28
201 0.32
202 0.35
203 0.39
204 0.42
205 0.48
206 0.41
207 0.36
208 0.36
209 0.33
210 0.31
211 0.28
212 0.22
213 0.16
214 0.14
215 0.11
216 0.1
217 0.09
218 0.11
219 0.12
220 0.13
221 0.13
222 0.13
223 0.13
224 0.13
225 0.14
226 0.12
227 0.1
228 0.12
229 0.18
230 0.18
231 0.23
232 0.24
233 0.23
234 0.23
235 0.24
236 0.24
237 0.23
238 0.25
239 0.22
240 0.25
241 0.26
242 0.26
243 0.25
244 0.28
245 0.3
246 0.38
247 0.39
248 0.38
249 0.4
250 0.38
251 0.4
252 0.36
253 0.37
254 0.32
255 0.33
256 0.33
257 0.33
258 0.33
259 0.31
260 0.34
261 0.27
262 0.28
263 0.25
264 0.27
265 0.27
266 0.29
267 0.3
268 0.29
269 0.34
270 0.3
271 0.35
272 0.34
273 0.36
274 0.34
275 0.34
276 0.34
277 0.3
278 0.28
279 0.21
280 0.18
281 0.13
282 0.15
283 0.14
284 0.11
285 0.1
286 0.1
287 0.09
288 0.13
289 0.14
290 0.16
291 0.25
292 0.32
293 0.37
294 0.4
295 0.41
296 0.4
297 0.44
298 0.4
299 0.41
300 0.45
301 0.51
302 0.58
303 0.63
304 0.66
305 0.64
306 0.69
307 0.69
308 0.69
309 0.69
310 0.67
311 0.66
312 0.66
313 0.74
314 0.73
315 0.72
316 0.71
317 0.68
318 0.69
319 0.67
320 0.64
321 0.61
322 0.57
323 0.56
324 0.55
325 0.55
326 0.54
327 0.51
328 0.5
329 0.45
330 0.44
331 0.4
332 0.32
333 0.31
334 0.24
335 0.22
336 0.24
337 0.24
338 0.26
339 0.27
340 0.26
341 0.22
342 0.3
343 0.36