FuNGI

Q12196

Protein Details

Accession

Q12196

Localization Confidence

High

Confidence Score

16.9

NoLS Segment(s)

Position	Sequence	Protein Nature
433-484	DEPKVLKGKKHEDKDLKKLRKQEAKDAKREKRKTKVKKHIKKKLVKKTKSKK	Basic

NLS Segment(s)

Position	Sequence
438-484	LKGKKHEDKDLKKLRKQEAKDAKREKRKTKVKKHIKKKLVKKTKSKK

Subcellular Location(s)

nucl 24, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR000719 Prot_kinase_dom IPR000687 RIO_kinase IPR018935 RIO_kinase_CS IPR017407 Ser/Thr_kinase_Rio1
Gene Ontology	GO:0005737 C:cytoplasm GO:0005829 C:cytosol GO:0030874 C:nucleolar chromatin GO:0005634 C:nucleus GO:0030688 C:preribosome, small subunit precursor GO:0005524 F:ATP binding GO:0016787 F:hydrolase activity GO:0046872 F:metal ion binding GO:0004672 F:protein kinase activity GO:0106310 F:protein serine kinase activity GO:0004674 F:protein serine/threonine kinase activity GO:0007049 P:cell cycle GO:0051301 P:cell division GO:0030490 P:maturation of SSU-rRNA GO:0000462 P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0016479 P:negative regulation of transcription by RNA polymerase I GO:2000234 P:positive regulation of rRNA processing GO:0006468 P:protein phosphorylation GO:0007096 P:regulation of exit from mitosis
KEGG	sce:YOR119C -
Pfam	View protein in Pfam PF01163 RIO1
PROSITE	View protein in PROSITE PS50011 PROTEIN_KINASE_DOM PS01245 RIO1
CDD	cd05147 RIO1_euk

Amino Acid Sequences

MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHECSSGTEEFSDDEEDGSSGSEEDDEEEGEYYDDDEPKVLKGKKHEDKDLKKLRKQEAKDAKREKRKTKVKKHIKKKLVKKTKSKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.15
3	0.15
4	0.16
5	0.16
6	0.19
7	0.22
8	0.22
9	0.23
10	0.25
11	0.24
12	0.26
13	0.26
14	0.27
15	0.32
16	0.38
17	0.39
18	0.37
19	0.4
20	0.46
21	0.48
22	0.51
23	0.45
24	0.46
25	0.45
26	0.44
27	0.48
28	0.43
29	0.42
30	0.42
31	0.46
32	0.5
33	0.58
34	0.67
35	0.65
36	0.72
37	0.73
38	0.69
39	0.66
40	0.6
41	0.54
42	0.48
43	0.43
44	0.35
45	0.32
46	0.29
47	0.25
48	0.29
49	0.26
50	0.23
51	0.23
52	0.22
53	0.26
54	0.32
55	0.36
56	0.31
57	0.32
58	0.31
59	0.29
60	0.31
61	0.26
62	0.19
63	0.16
64	0.13
65	0.12
66	0.11
67	0.11
68	0.08
69	0.08
70	0.11
71	0.1
72	0.11
73	0.13
74	0.13
75	0.19
76	0.22
77	0.23
78	0.2
79	0.19
80	0.18
81	0.15
82	0.16
83	0.12
84	0.1
85	0.09
86	0.09
87	0.09
88	0.09
89	0.12
90	0.11
91	0.11
92	0.11
93	0.13
94	0.14
95	0.13
96	0.13
97	0.09
98	0.09
99	0.09
100	0.08
101	0.05
102	0.06
103	0.08
104	0.08
105	0.08
106	0.08
107	0.09
108	0.1
109	0.13
110	0.17
111	0.16
112	0.16
113	0.17
114	0.2
115	0.2
116	0.22
117	0.24
118	0.22
119	0.26
120	0.28
121	0.33
122	0.38
123	0.37
124	0.37
125	0.34
126	0.33
127	0.33
128	0.37
129	0.33
130	0.34
131	0.34
132	0.35
133	0.37
134	0.36
135	0.39
136	0.35
137	0.44
138	0.46
139	0.56
140	0.63
141	0.68
142	0.76
143	0.74
144	0.78
145	0.71
146	0.69
147	0.66
148	0.66
149	0.6
150	0.59
151	0.59
152	0.51
153	0.57
154	0.58
155	0.52
156	0.48
157	0.45
158	0.41
159	0.44
160	0.45
161	0.39
162	0.33
163	0.32
164	0.3
165	0.33
166	0.31
167	0.24
168	0.24
169	0.22
170	0.2
171	0.21
172	0.18
173	0.21
174	0.23
175	0.26
176	0.28
177	0.29
178	0.28
179	0.26
180	0.25
181	0.18
182	0.16
183	0.13
184	0.09
185	0.08
186	0.08
187	0.08
188	0.08
189	0.09
190	0.08
191	0.11
192	0.15
193	0.15
194	0.17
195	0.19
196	0.2
197	0.24
198	0.3
199	0.38
200	0.42
201	0.47
202	0.48
203	0.48
204	0.48
205	0.48
206	0.46
207	0.4
208	0.35
209	0.3
210	0.28
211	0.27
212	0.25
213	0.2
214	0.14
215	0.11
216	0.09
217	0.07
218	0.07
219	0.07
220	0.08
221	0.07
222	0.1
223	0.14
224	0.13
225	0.14
226	0.15
227	0.14
228	0.15
229	0.15
230	0.13
231	0.09
232	0.12
233	0.11
234	0.1
235	0.1
236	0.09
237	0.1
238	0.09
239	0.09
240	0.06
241	0.06
242	0.07
243	0.07
244	0.07
245	0.06
246	0.06
247	0.06
248	0.06
249	0.07
250	0.07
251	0.07
252	0.07
253	0.07
254	0.08
255	0.08
256	0.08
257	0.07
258	0.07
259	0.08
260	0.08
261	0.09
262	0.08
263	0.08
264	0.1
265	0.1
266	0.12
267	0.11
268	0.12
269	0.15
270	0.15
271	0.17
272	0.15
273	0.16
274	0.15
275	0.14
276	0.14
277	0.09
278	0.09
279	0.07
280	0.09
281	0.1
282	0.1
283	0.1
284	0.1
285	0.1
286	0.11
287	0.14
288	0.11
289	0.09
290	0.1
291	0.09
292	0.11
293	0.11
294	0.11
295	0.09
296	0.11
297	0.12
298	0.1
299	0.11
300	0.13
301	0.17
302	0.19
303	0.21
304	0.22
305	0.24
306	0.24
307	0.24
308	0.2
309	0.15
310	0.13
311	0.1
312	0.07
313	0.05
314	0.05
315	0.06
316	0.07
317	0.07
318	0.07
319	0.08
320	0.09
321	0.1
322	0.13
323	0.14
324	0.14
325	0.15
326	0.17
327	0.18
328	0.18
329	0.17
330	0.14
331	0.13
332	0.12
333	0.1
334	0.1
335	0.08
336	0.11
337	0.11
338	0.11
339	0.11
340	0.13
341	0.13
342	0.12
343	0.13
344	0.11
345	0.1
346	0.13
347	0.13
348	0.14
349	0.15
350	0.14
351	0.17
352	0.18
353	0.18
354	0.2
355	0.2
356	0.19
357	0.2
358	0.21
359	0.21
360	0.2
361	0.2
362	0.16
363	0.19
364	0.22
365	0.23
366	0.25
367	0.25
368	0.27
369	0.28
370	0.28
371	0.25
372	0.21
373	0.2
374	0.2
375	0.16
376	0.15
377	0.16
378	0.16
379	0.15
380	0.15
381	0.15
382	0.17
383	0.16
384	0.17
385	0.15
386	0.14
387	0.14
388	0.13
389	0.18
390	0.13
391	0.13
392	0.11
393	0.12
394	0.13
395	0.14
396	0.15
397	0.11
398	0.1
399	0.1
400	0.1
401	0.09
402	0.09
403	0.08
404	0.06
405	0.06
406	0.06
407	0.06
408	0.08
409	0.08
410	0.08
411	0.09
412	0.09
413	0.09
414	0.09
415	0.09
416	0.09
417	0.11
418	0.12
419	0.11
420	0.12
421	0.13
422	0.15
423	0.23
424	0.26
425	0.27
426	0.36
427	0.47
428	0.55
429	0.62
430	0.71
431	0.73
432	0.78
433	0.85
434	0.86
435	0.86
436	0.82
437	0.83
438	0.83
439	0.82
440	0.79
441	0.79
442	0.79
443	0.79
444	0.84
445	0.85
446	0.86
447	0.87
448	0.91
449	0.9
450	0.9
451	0.91
452	0.91
453	0.92
454	0.93
455	0.93
456	0.94
457	0.95
458	0.95
459	0.95
460	0.95
461	0.94
462	0.94
463	0.94
464	0.93

Q12196

3D AlphaFold-predicted Structure Viewer