Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q03497

Protein Details
Accession Q03497    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
224-252SASHSLSNPKHKQHKPKVKPSKPEAKSKPHydrophilic
584-609LSKELNEKKREERERRKKQLYAKLNEBasic
NLS Segment(s)
PositionSequence
232-274PKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQ
590-601EKKREERERRKK
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR011009  Kinase-like_dom_sf  
IPR033923  PAK_BD  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000131  C:incipient cellular bud site  
GO:0043332  C:mating projection tip  
GO:0005634  C:nucleus  
GO:0005886  C:plasma membrane  
GO:0005524  F:ATP binding  
GO:0044025  F:histone H2BS14 kinase activity  
GO:0003729  F:mRNA binding  
GO:0004672  F:protein kinase activity  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0007121  P:bipolar cellular bud site selection  
GO:0007118  P:budding cell apical bud growth  
GO:0000282  P:cellular bud site selection  
GO:0035556  P:intracellular signal transduction  
GO:0001403  P:invasive growth in response to glucose limitation  
GO:0010629  P:negative regulation of gene expression  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0007232  P:osmosensory signaling pathway via Sho1 osmosensor  
GO:0000750  P:pheromone-dependent signal transduction involved in conjugation with cellular fusion  
GO:0043065  P:positive regulation of apoptotic process  
GO:0006468  P:protein phosphorylation  
GO:0007124  P:pseudohyphal growth  
GO:0007096  P:regulation of exit from mitosis  
GO:0043408  P:regulation of MAPK cascade  
GO:0001402  P:signal transduction involved in filamentous growth  
GO:0035376  P:sterol import  
GO:0034063  P:stress granule assembly  
GO:0000011  P:vacuole inheritance  
KEGG sce:YHL007C  -  
Pfam View protein in Pfam  
PF00786  PBD  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50108  CRIB  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd01093  CRIB_PAK_like  
cd06614  STKc_PAK  
Amino Acid Sequences MSNDPSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGLRLPRTTGTLNVNALQKGTNAAHEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAVTPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQPVASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGTLRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTETNGEDKMFKTFNTTTGLPGSPQVSTPPANSFNKFPPSTSDSHNYGSRTGTPMSNHVMSPTLNTDSSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNATLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQETVTTPTSKPAQARSLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLARLKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.26
4 0.22
5 0.22
6 0.2
7 0.22
8 0.22
9 0.23
10 0.23
11 0.22
12 0.19
13 0.17
14 0.18
15 0.14
16 0.14
17 0.11
18 0.12
19 0.11
20 0.11
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.11
28 0.12
29 0.13
30 0.16
31 0.18
32 0.22
33 0.27
34 0.29
35 0.32
36 0.35
37 0.37
38 0.35
39 0.33
40 0.29
41 0.23
42 0.23
43 0.22
44 0.2
45 0.19
46 0.2
47 0.19
48 0.19
49 0.2
50 0.16
51 0.18
52 0.16
53 0.14
54 0.18
55 0.24
56 0.25
57 0.25
58 0.28
59 0.28
60 0.33
61 0.33
62 0.3
63 0.28
64 0.3
65 0.35
66 0.33
67 0.31
68 0.26
69 0.25
70 0.24
71 0.2
72 0.16
73 0.1
74 0.09
75 0.1
76 0.12
77 0.13
78 0.13
79 0.14
80 0.14
81 0.14
82 0.17
83 0.16
84 0.17
85 0.16
86 0.17
87 0.16
88 0.17
89 0.17
90 0.13
91 0.12
92 0.1
93 0.1
94 0.08
95 0.08
96 0.1
97 0.12
98 0.12
99 0.13
100 0.16
101 0.18
102 0.19
103 0.22
104 0.25
105 0.26
106 0.26
107 0.25
108 0.23
109 0.21
110 0.22
111 0.2
112 0.19
113 0.17
114 0.17
115 0.18
116 0.18
117 0.17
118 0.17
119 0.21
120 0.19
121 0.2
122 0.2
123 0.2
124 0.24
125 0.24
126 0.24
127 0.19
128 0.2
129 0.19
130 0.17
131 0.16
132 0.14
133 0.14
134 0.13
135 0.13
136 0.14
137 0.17
138 0.2
139 0.24
140 0.22
141 0.23
142 0.23
143 0.21
144 0.22
145 0.19
146 0.17
147 0.13
148 0.14
149 0.13
150 0.13
151 0.15
152 0.13
153 0.14
154 0.15
155 0.14
156 0.15
157 0.16
158 0.15
159 0.15
160 0.15
161 0.13
162 0.12
163 0.12
164 0.13
165 0.15
166 0.17
167 0.19
168 0.2
169 0.21
170 0.23
171 0.26
172 0.28
173 0.26
174 0.24
175 0.26
176 0.32
177 0.34
178 0.33
179 0.3
180 0.26
181 0.27
182 0.33
183 0.32
184 0.34
185 0.34
186 0.34
187 0.4
188 0.41
189 0.4
190 0.37
191 0.37
192 0.32
193 0.29
194 0.3
195 0.26
196 0.28
197 0.27
198 0.23
199 0.21
200 0.22
201 0.26
202 0.28
203 0.3
204 0.35
205 0.44
206 0.44
207 0.44
208 0.41
209 0.38
210 0.4
211 0.42
212 0.34
213 0.27
214 0.27
215 0.32
216 0.36
217 0.43
218 0.43
219 0.46
220 0.55
221 0.61
222 0.71
223 0.76
224 0.82
225 0.82
226 0.87
227 0.91
228 0.89
229 0.91
230 0.89
231 0.88
232 0.82
233 0.83
234 0.78
235 0.77
236 0.73
237 0.7
238 0.71
239 0.69
240 0.72
241 0.66
242 0.66
243 0.63
244 0.69
245 0.66
246 0.61
247 0.63
248 0.65
249 0.69
250 0.7
251 0.7
252 0.65
253 0.7
254 0.75
255 0.75
256 0.76
257 0.73
258 0.73
259 0.75
260 0.73
261 0.75
262 0.74
263 0.7
264 0.65
265 0.65
266 0.61
267 0.58
268 0.62
269 0.6
270 0.61
271 0.61
272 0.63
273 0.6
274 0.63
275 0.66
276 0.69
277 0.67
278 0.67
279 0.63
280 0.62
281 0.62
282 0.55
283 0.48
284 0.39
285 0.32
286 0.23
287 0.21
288 0.19
289 0.15
290 0.2
291 0.18
292 0.22
293 0.25
294 0.29
295 0.31
296 0.33
297 0.36
298 0.34
299 0.4
300 0.41
301 0.47
302 0.48
303 0.51
304 0.5
305 0.47
306 0.46
307 0.45
308 0.44
309 0.41
310 0.41
311 0.37
312 0.34
313 0.34
314 0.33
315 0.29
316 0.24
317 0.19
318 0.14
319 0.13
320 0.12
321 0.12
322 0.11
323 0.11
324 0.11
325 0.15
326 0.19
327 0.19
328 0.23
329 0.26
330 0.26
331 0.31
332 0.33
333 0.29
334 0.26
335 0.26
336 0.25
337 0.23
338 0.24
339 0.18
340 0.16
341 0.13
342 0.13
343 0.11
344 0.08
345 0.08
346 0.08
347 0.08
348 0.08
349 0.09
350 0.1
351 0.1
352 0.11
353 0.09
354 0.08
355 0.08
356 0.08
357 0.08
358 0.12
359 0.15
360 0.18
361 0.19
362 0.24
363 0.31
364 0.4
365 0.41
366 0.38
367 0.43
368 0.45
369 0.46
370 0.41
371 0.33
372 0.25
373 0.23
374 0.21
375 0.13
376 0.07
377 0.06
378 0.06
379 0.05
380 0.06
381 0.05
382 0.06
383 0.1
384 0.12
385 0.12
386 0.13
387 0.15
388 0.14
389 0.14
390 0.14
391 0.13
392 0.11
393 0.1
394 0.16
395 0.15
396 0.17
397 0.21
398 0.21
399 0.19
400 0.21
401 0.22
402 0.16
403 0.16
404 0.15
405 0.11
406 0.11
407 0.11
408 0.11
409 0.11
410 0.12
411 0.14
412 0.19
413 0.21
414 0.22
415 0.24
416 0.26
417 0.31
418 0.31
419 0.27
420 0.27
421 0.29
422 0.3
423 0.31
424 0.31
425 0.28
426 0.3
427 0.32
428 0.28
429 0.25
430 0.24
431 0.21
432 0.19
433 0.17
434 0.16
435 0.14
436 0.16
437 0.18
438 0.18
439 0.17
440 0.14
441 0.14
442 0.13
443 0.13
444 0.12
445 0.11
446 0.1
447 0.1
448 0.11
449 0.1
450 0.11
451 0.14
452 0.13
453 0.12
454 0.12
455 0.12
456 0.13
457 0.14
458 0.19
459 0.17
460 0.23
461 0.24
462 0.33
463 0.37
464 0.39
465 0.41
466 0.37
467 0.4
468 0.37
469 0.37
470 0.29
471 0.29
472 0.27
473 0.25
474 0.23
475 0.18
476 0.15
477 0.13
478 0.12
479 0.09
480 0.12
481 0.12
482 0.12
483 0.12
484 0.14
485 0.15
486 0.16
487 0.16
488 0.13
489 0.13
490 0.13
491 0.16
492 0.16
493 0.17
494 0.19
495 0.24
496 0.27
497 0.28
498 0.37
499 0.37
500 0.38
501 0.42
502 0.42
503 0.44
504 0.44
505 0.47
506 0.42
507 0.41
508 0.43
509 0.45
510 0.48
511 0.47
512 0.47
513 0.43
514 0.43
515 0.44
516 0.41
517 0.41
518 0.41
519 0.4
520 0.38
521 0.4
522 0.4
523 0.4
524 0.41
525 0.39
526 0.34
527 0.37
528 0.38
529 0.39
530 0.4
531 0.39
532 0.41
533 0.4
534 0.4
535 0.35
536 0.35
537 0.3
538 0.29
539 0.29
540 0.27
541 0.25
542 0.23
543 0.22
544 0.24
545 0.28
546 0.28
547 0.26
548 0.26
549 0.27
550 0.29
551 0.31
552 0.26
553 0.22
554 0.22
555 0.24
556 0.21
557 0.25
558 0.24
559 0.22
560 0.22
561 0.24
562 0.23
563 0.22
564 0.22
565 0.22
566 0.26
567 0.29
568 0.34
569 0.36
570 0.41
571 0.39
572 0.39
573 0.44
574 0.46
575 0.52
576 0.52
577 0.5
578 0.5
579 0.59
580 0.68
581 0.69
582 0.73
583 0.74
584 0.81
585 0.88
586 0.88
587 0.84
588 0.83
589 0.83
590 0.81
591 0.75
592 0.73
593 0.68
594 0.62
595 0.56
596 0.48
597 0.38
598 0.29
599 0.26
600 0.17
601 0.14
602 0.14
603 0.14
604 0.15
605 0.14
606 0.15
607 0.15
608 0.17
609 0.18
610 0.19
611 0.18
612 0.2
613 0.19
614 0.18
615 0.15
616 0.12
617 0.1
618 0.09
619 0.08
620 0.04
621 0.04
622 0.04
623 0.04
624 0.04
625 0.04
626 0.04
627 0.05
628 0.05
629 0.05
630 0.05
631 0.05
632 0.05
633 0.06
634 0.06
635 0.06
636 0.07
637 0.11
638 0.15
639 0.2
640 0.29
641 0.34
642 0.37
643 0.44
644 0.45
645 0.43
646 0.44
647 0.41
648 0.39
649 0.39
650 0.35
651 0.3
652 0.29
653 0.26
654 0.21
655 0.19
656 0.14
657 0.15
658 0.18
659 0.18
660 0.21
661 0.23
662 0.26
663 0.32
664 0.32
665 0.27
666 0.24
667 0.23
668 0.22
669 0.2
670 0.18
671 0.13
672 0.12
673 0.1
674 0.09
675 0.1
676 0.08
677 0.1
678 0.09
679 0.07
680 0.07
681 0.07
682 0.07
683 0.06
684 0.05
685 0.04
686 0.04
687 0.04
688 0.04
689 0.04
690 0.06
691 0.06
692 0.08
693 0.08
694 0.08
695 0.08
696 0.09
697 0.09
698 0.08
699 0.1
700 0.09
701 0.09
702 0.1
703 0.11
704 0.1
705 0.11
706 0.1
707 0.07
708 0.08
709 0.07
710 0.07
711 0.08
712 0.09
713 0.08
714 0.1
715 0.11
716 0.11
717 0.13
718 0.12
719 0.1
720 0.13
721 0.17
722 0.22
723 0.24
724 0.26
725 0.29
726 0.3
727 0.32
728 0.32
729 0.29
730 0.23
731 0.22
732 0.19
733 0.15
734 0.14
735 0.13
736 0.11
737 0.09
738 0.09
739 0.08
740 0.08
741 0.09
742 0.08
743 0.07
744 0.06
745 0.07
746 0.1
747 0.1
748 0.11
749 0.11
750 0.14
751 0.15
752 0.2
753 0.21
754 0.22
755 0.23
756 0.22
757 0.22
758 0.2
759 0.21
760 0.18
761 0.2
762 0.17
763 0.19
764 0.2
765 0.2
766 0.2
767 0.19
768 0.16
769 0.12
770 0.19
771 0.21
772 0.22
773 0.23
774 0.23
775 0.25
776 0.32
777 0.35
778 0.32
779 0.31
780 0.31
781 0.35
782 0.36
783 0.34
784 0.29
785 0.27
786 0.22
787 0.19
788 0.16
789 0.1
790 0.07
791 0.06
792 0.04
793 0.04
794 0.04
795 0.04
796 0.04
797 0.05
798 0.05
799 0.06
800 0.11
801 0.11
802 0.12
803 0.13
804 0.15
805 0.18
806 0.18
807 0.19
808 0.15
809 0.15
810 0.15
811 0.18
812 0.17
813 0.15
814 0.14
815 0.14
816 0.17
817 0.19
818 0.17
819 0.16
820 0.21
821 0.24
822 0.28
823 0.33
824 0.39
825 0.41
826 0.44
827 0.46
828 0.48
829 0.46
830 0.5
831 0.43
832 0.35
833 0.33
834 0.38
835 0.43
836 0.37
837 0.39
838 0.36
839 0.37
840 0.38
841 0.37
842 0.32
843 0.25
844 0.26
845 0.23
846 0.19
847 0.21
848 0.2
849 0.19
850 0.2
851 0.19
852 0.18
853 0.18
854 0.17
855 0.14
856 0.13
857 0.14
858 0.1
859 0.09
860 0.07
861 0.07
862 0.08
863 0.08
864 0.08
865 0.08
866 0.08
867 0.08
868 0.08
869 0.08
870 0.09
871 0.11
872 0.14
873 0.2
874 0.23
875 0.31
876 0.35
877 0.38
878 0.43
879 0.5
880 0.51
881 0.5
882 0.5
883 0.44
884 0.45
885 0.42
886 0.37
887 0.29
888 0.24
889 0.2
890 0.17
891 0.15
892 0.1
893 0.1
894 0.11
895 0.12
896 0.12
897 0.13
898 0.18
899 0.22
900 0.25
901 0.3
902 0.37
903 0.41
904 0.41
905 0.45
906 0.46
907 0.51
908 0.53
909 0.5
910 0.43
911 0.38
912 0.39
913 0.37
914 0.33
915 0.27
916 0.22
917 0.2
918 0.2
919 0.22