Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P47019

Protein Details
Accession P47019    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-34TSNLHHKVHSLNKKRAQRERAGHydrophilic
NLS Segment(s)
PositionSequence
26-27KR
91-96KKRAKK
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG sce:YJL122W  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MPSKNSINRPKLTSNLHHKVHSLNKKRAQRERAGLLKPARSSVNSKSGEIKSVALDLYFQNKKNESQNSTAVTLQNASSSPASITTRTLSKKRAKKIERNLKYATQRKLLVDASAKLEDEMDIDLDGGKKVKENEKKSSLTLVKEALWSVIDDTASQGLIIENGQGTTLGGPFFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.64
4 0.6
5 0.56
6 0.56
7 0.59
8 0.6
9 0.6
10 0.6
11 0.66
12 0.73
13 0.81
14 0.83
15 0.8
16 0.79
17 0.77
18 0.75
19 0.75
20 0.68
21 0.66
22 0.61
23 0.59
24 0.5
25 0.45
26 0.38
27 0.33
28 0.35
29 0.33
30 0.38
31 0.35
32 0.35
33 0.39
34 0.38
35 0.38
36 0.34
37 0.3
38 0.21
39 0.2
40 0.18
41 0.11
42 0.12
43 0.1
44 0.16
45 0.18
46 0.2
47 0.22
48 0.24
49 0.27
50 0.33
51 0.38
52 0.35
53 0.36
54 0.38
55 0.37
56 0.37
57 0.36
58 0.29
59 0.23
60 0.2
61 0.15
62 0.12
63 0.09
64 0.09
65 0.08
66 0.08
67 0.07
68 0.09
69 0.1
70 0.1
71 0.11
72 0.1
73 0.14
74 0.17
75 0.2
76 0.25
77 0.33
78 0.4
79 0.47
80 0.56
81 0.6
82 0.66
83 0.75
84 0.79
85 0.77
86 0.76
87 0.72
88 0.68
89 0.69
90 0.67
91 0.6
92 0.53
93 0.49
94 0.43
95 0.44
96 0.37
97 0.31
98 0.26
99 0.23
100 0.22
101 0.21
102 0.2
103 0.16
104 0.16
105 0.13
106 0.11
107 0.1
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.09
117 0.13
118 0.22
119 0.31
120 0.37
121 0.45
122 0.51
123 0.54
124 0.53
125 0.59
126 0.53
127 0.47
128 0.43
129 0.37
130 0.31
131 0.3
132 0.28
133 0.2
134 0.16
135 0.14
136 0.12
137 0.12
138 0.1
139 0.09
140 0.11
141 0.11
142 0.1
143 0.09
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.08