Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P06780

Protein Details
Accession P06780   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
184-209LMGKSKTNGKAKKNTTEKKKKKCVLLHydrophilic
NLS Segment(s)
PositionSequence
187-205KSKTNGKAKKNTTEKKKKK
Subcellular Location(s) mito 10, cyto_mito 9.666, mito_nucl 9.666, cyto_nucl 8.666, nucl 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0000148  C:1,3-beta-D-glucan synthase complex  
GO:0071944  C:cell periphery  
GO:0005933  C:cellular bud  
GO:0005935  C:cellular bud neck  
GO:0005934  C:cellular bud tip  
GO:0005737  C:cytoplasm  
GO:0005783  C:endoplasmic reticulum  
GO:0010008  C:endosome membrane  
GO:0000329  C:fungal-type vacuole membrane  
GO:0005794  C:Golgi apparatus  
GO:0000131  C:incipient cellular bud site  
GO:0043332  C:mating projection tip  
GO:0005741  C:mitochondrial outer membrane  
GO:0005739  C:mitochondrion  
GO:0005778  C:peroxisomal membrane  
GO:0005777  C:peroxisome  
GO:0005886  C:plasma membrane  
GO:0031681  F:G-protein beta-subunit binding  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0006075  P:(1->3)-beta-D-glucan biosynthetic process  
GO:0030036  P:actin cytoskeleton organization  
GO:0031532  P:actin cytoskeleton reorganization  
GO:0030476  P:ascospore wall assembly  
GO:0007117  P:budding cell bud growth  
GO:0032186  P:cellular bud neck septin ring organization  
GO:0009272  P:fungal-type cell wall biogenesis  
GO:0045807  P:positive regulation of endocytosis  
GO:1903501  P:positive regulation of mitotic actomyosin contractile ring assembly  
GO:0090037  P:positive regulation of protein kinase C signaling  
GO:0008361  P:regulation of cell size  
GO:0090334  P:regulation of cell wall (1->3)-beta-D-glucan biosynthetic process  
GO:0060178  P:regulation of exocyst localization  
GO:0060237  P:regulation of fungal-type cell wall organization  
GO:0032880  P:regulation of protein localization  
GO:1903395  P:regulation of secondary cell septum biogenesis  
GO:0032889  P:regulation of vacuole fusion, non-autophagic  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG sce:YPR165W  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51420  RHO  
CDD cd01870  RhoA_like  
Amino Acid Sequences MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.26
5 0.27
6 0.26
7 0.24
8 0.19
9 0.15
10 0.13
11 0.12
12 0.09
13 0.09
14 0.1
15 0.12
16 0.19
17 0.19
18 0.23
19 0.22
20 0.23
21 0.21
22 0.22
23 0.25
24 0.2
25 0.22
26 0.18
27 0.19
28 0.19
29 0.2
30 0.18
31 0.12
32 0.11
33 0.09
34 0.1
35 0.09
36 0.07
37 0.06
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.07
47 0.09
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.1
54 0.08
55 0.06
56 0.07
57 0.09
58 0.12
59 0.13
60 0.13
61 0.13
62 0.13
63 0.17
64 0.23
65 0.22
66 0.21
67 0.22
68 0.24
69 0.24
70 0.23
71 0.19
72 0.12
73 0.1
74 0.08
75 0.06
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.08
90 0.08
91 0.1
92 0.08
93 0.08
94 0.09
95 0.1
96 0.13
97 0.13
98 0.12
99 0.11
100 0.11
101 0.11
102 0.09
103 0.08
104 0.04
105 0.04
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.07
112 0.1
113 0.15
114 0.2
115 0.21
116 0.22
117 0.22
118 0.27
119 0.27
120 0.26
121 0.22
122 0.19
123 0.19
124 0.19
125 0.22
126 0.2
127 0.2
128 0.21
129 0.2
130 0.21
131 0.24
132 0.23
133 0.2
134 0.18
135 0.18
136 0.16
137 0.15
138 0.14
139 0.1
140 0.11
141 0.1
142 0.09
143 0.08
144 0.07
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.07
152 0.08
153 0.07
154 0.09
155 0.14
156 0.14
157 0.22
158 0.22
159 0.22
160 0.22
161 0.23
162 0.21
163 0.18
164 0.18
165 0.1
166 0.11
167 0.1
168 0.1
169 0.1
170 0.12
171 0.14
172 0.17
173 0.21
174 0.22
175 0.3
176 0.39
177 0.48
178 0.53
179 0.58
180 0.64
181 0.68
182 0.77
183 0.8
184 0.81
185 0.83
186 0.86
187 0.88
188 0.89
189 0.93