Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P33300

Protein Details
Accession P33300   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
336-355TLLARQQKRLRKDSNTNIVLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, E.R. 7, golg 5, mito 1, cyto 1, extr 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0000324  C:fungal-type vacuole  
GO:0000329  C:fungal-type vacuole membrane  
GO:0005794  C:Golgi apparatus  
GO:0031501  C:mannosyltransferase complex  
GO:0103064  F:inositol phosphorylceramide mannosyltransferase activity  
GO:0000030  F:mannosyltransferase activity  
GO:0006688  P:glycosphingolipid biosynthetic process  
GO:0006676  P:mannosyl diphosphorylinositol ceramide metabolic process  
GO:0051999  P:mannosyl-inositol phosphorylceramide biosynthetic process  
GO:0006675  P:mannosyl-inositol phosphorylceramide metabolic process  
GO:0030148  P:sphingolipid biosynthetic process  
KEGG sce:YPL057C  -  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
Amino Acid Sequences MRKELKYLICFNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSYSFFSITKGSSWHLDDAKLMKALENHILSCVVTGFIFGFFILYGEFTFYCWLCSKNFSNLTKNWKLNAIKVRFVTILNSLGLRLKLSKSTSDTASATLLARQQKRLRKDSNTNIVLLKSSRKSDVYDLEKNDSSKYSLGNNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.16
4 0.12
5 0.12
6 0.12
7 0.07
8 0.07
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.09
18 0.09
19 0.09
20 0.11
21 0.12
22 0.12
23 0.1
24 0.11
25 0.1
26 0.11
27 0.12
28 0.1
29 0.11
30 0.11
31 0.12
32 0.11
33 0.13
34 0.13
35 0.14
36 0.16
37 0.16
38 0.2
39 0.24
40 0.31
41 0.35
42 0.36
43 0.42
44 0.5
45 0.5
46 0.51
47 0.47
48 0.46
49 0.45
50 0.49
51 0.43
52 0.34
53 0.32
54 0.31
55 0.38
56 0.35
57 0.36
58 0.31
59 0.35
60 0.42
61 0.48
62 0.54
63 0.5
64 0.5
65 0.48
66 0.56
67 0.58
68 0.55
69 0.54
70 0.47
71 0.46
72 0.44
73 0.41
74 0.34
75 0.27
76 0.22
77 0.17
78 0.15
79 0.13
80 0.15
81 0.15
82 0.14
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.08
89 0.08
90 0.1
91 0.12
92 0.12
93 0.12
94 0.13
95 0.13
96 0.15
97 0.17
98 0.17
99 0.16
100 0.16
101 0.17
102 0.17
103 0.17
104 0.17
105 0.16
106 0.18
107 0.2
108 0.27
109 0.26
110 0.27
111 0.26
112 0.25
113 0.23
114 0.19
115 0.19
116 0.12
117 0.11
118 0.09
119 0.1
120 0.09
121 0.09
122 0.09
123 0.06
124 0.07
125 0.06
126 0.06
127 0.06
128 0.07
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.1
135 0.09
136 0.11
137 0.14
138 0.14
139 0.14
140 0.13
141 0.19
142 0.17
143 0.17
144 0.17
145 0.15
146 0.17
147 0.18
148 0.21
149 0.18
150 0.2
151 0.22
152 0.21
153 0.2
154 0.17
155 0.16
156 0.13
157 0.1
158 0.08
159 0.09
160 0.11
161 0.1
162 0.12
163 0.12
164 0.13
165 0.16
166 0.22
167 0.21
168 0.24
169 0.28
170 0.29
171 0.33
172 0.37
173 0.4
174 0.37
175 0.37
176 0.35
177 0.36
178 0.38
179 0.37
180 0.33
181 0.27
182 0.23
183 0.22
184 0.2
185 0.15
186 0.11
187 0.08
188 0.07
189 0.07
190 0.06
191 0.06
192 0.04
193 0.04
194 0.04
195 0.04
196 0.08
197 0.08
198 0.13
199 0.15
200 0.16
201 0.19
202 0.27
203 0.36
204 0.41
205 0.51
206 0.55
207 0.62
208 0.7
209 0.75
210 0.77
211 0.76
212 0.7
213 0.62
214 0.55
215 0.5
216 0.42
217 0.36
218 0.27
219 0.22
220 0.23
221 0.22
222 0.21
223 0.17
224 0.21
225 0.2
226 0.23
227 0.22
228 0.24
229 0.23
230 0.23
231 0.23
232 0.2
233 0.19
234 0.17
235 0.15
236 0.14
237 0.15
238 0.18
239 0.18
240 0.17
241 0.19
242 0.2
243 0.2
244 0.19
245 0.17
246 0.15
247 0.16
248 0.17
249 0.21
250 0.2
251 0.18
252 0.17
253 0.17
254 0.15
255 0.14
256 0.12
257 0.07
258 0.06
259 0.06
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.04
266 0.05
267 0.04
268 0.04
269 0.04
270 0.06
271 0.06
272 0.06
273 0.09
274 0.08
275 0.11
276 0.12
277 0.13
278 0.13
279 0.19
280 0.21
281 0.28
282 0.37
283 0.39
284 0.44
285 0.48
286 0.56
287 0.59
288 0.59
289 0.52
290 0.52
291 0.5
292 0.51
293 0.55
294 0.51
295 0.47
296 0.45
297 0.47
298 0.4
299 0.38
300 0.33
301 0.26
302 0.24
303 0.19
304 0.18
305 0.16
306 0.17
307 0.17
308 0.16
309 0.16
310 0.15
311 0.2
312 0.22
313 0.27
314 0.29
315 0.33
316 0.33
317 0.35
318 0.34
319 0.3
320 0.29
321 0.25
322 0.2
323 0.19
324 0.22
325 0.25
326 0.28
327 0.35
328 0.42
329 0.49
330 0.58
331 0.65
332 0.69
333 0.7
334 0.78
335 0.8
336 0.82
337 0.77
338 0.7
339 0.63
340 0.55
341 0.48
342 0.4
343 0.37
344 0.31
345 0.32
346 0.34
347 0.34
348 0.37
349 0.4
350 0.47
351 0.48
352 0.51
353 0.52
354 0.54
355 0.56
356 0.53
357 0.49
358 0.42
359 0.37
360 0.31
361 0.29
362 0.29