Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q12041

Protein Details
Accession Q12041    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-95ALPKPPKSSKSKPQDRRNSTGEHydrophilic
NLS Segment(s)
PositionSequence
70-90KKENALPKPPKSSKSKPQDRR
Subcellular Location(s) nucl 23, cyto_nucl 16.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046872  F:metal ion binding  
GO:0061629  F:RNA polymerase II-specific DNA-binding transcription factor binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0007346  P:regulation of mitotic cell cycle  
GO:0031335  P:regulation of sulfur amino acid metabolic process  
GO:0042762  P:regulation of sulfur metabolic process  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG sce:YDR253C  -  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MEDQDAAFIKQATEAIVDVSLNIDNIDPIIKELLERVRNRQNRLQNKKPALIPAENGVDINSQGGNIKVKKENALPKPPKSSKSKPQDRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNRTKLLTAGGEGINELLKKVKQSNIVHRQDNNHNGSSNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.09
5 0.08
6 0.09
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.07
16 0.08
17 0.07
18 0.08
19 0.11
20 0.19
21 0.25
22 0.27
23 0.33
24 0.42
25 0.49
26 0.55
27 0.6
28 0.62
29 0.66
30 0.74
31 0.77
32 0.76
33 0.77
34 0.76
35 0.69
36 0.65
37 0.59
38 0.51
39 0.43
40 0.36
41 0.32
42 0.27
43 0.25
44 0.19
45 0.14
46 0.12
47 0.12
48 0.08
49 0.06
50 0.06
51 0.07
52 0.11
53 0.12
54 0.16
55 0.19
56 0.2
57 0.23
58 0.29
59 0.37
60 0.39
61 0.49
62 0.52
63 0.52
64 0.61
65 0.62
66 0.62
67 0.61
68 0.62
69 0.61
70 0.66
71 0.72
72 0.72
73 0.79
74 0.84
75 0.82
76 0.8
77 0.76
78 0.74
79 0.68
80 0.68
81 0.66
82 0.57
83 0.55
84 0.58
85 0.55
86 0.5
87 0.51
88 0.46
89 0.41
90 0.46
91 0.45
92 0.43
93 0.43
94 0.41
95 0.42
96 0.38
97 0.36
98 0.35
99 0.36
100 0.38
101 0.4
102 0.42
103 0.38
104 0.44
105 0.44
106 0.47
107 0.45
108 0.38
109 0.4
110 0.36
111 0.36
112 0.35
113 0.32
114 0.24
115 0.21
116 0.21
117 0.18
118 0.23
119 0.22
120 0.24
121 0.3
122 0.34
123 0.42
124 0.45
125 0.48
126 0.53
127 0.57
128 0.55
129 0.53
130 0.53
131 0.5
132 0.49
133 0.5
134 0.51
135 0.55
136 0.54
137 0.58
138 0.61
139 0.62
140 0.66
141 0.66
142 0.64
143 0.61
144 0.61
145 0.56
146 0.5
147 0.48
148 0.42
149 0.33
150 0.25
151 0.18
152 0.14
153 0.12
154 0.11
155 0.11
156 0.12
157 0.16
158 0.2
159 0.25
160 0.33
161 0.41
162 0.51
163 0.59
164 0.65
165 0.68
166 0.68
167 0.7
168 0.7
169 0.72
170 0.67
171 0.59