Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P31027

Protein Details
Accession P31027    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNVPKTRKTYCKGKECRKHAQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0046677  P:response to antibiotic  
GO:0046898  P:response to cycloheximide  
GO:0006412  P:translation  
KEGG kla:KLLA0_D07832g  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKECRKHAQHKVTQYKAGKASLYAQGKRRYDRKQSGFGGQTKQIFHKKAKTTKKVVLRLECMSCKTKTQLALKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.87
9 0.84
10 0.84
11 0.86
12 0.79
13 0.78
14 0.7
15 0.65
16 0.58
17 0.52
18 0.42
19 0.33
20 0.31
21 0.31
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.62
32 0.61
33 0.61
34 0.6
35 0.61
36 0.58
37 0.54
38 0.47
39 0.4
40 0.37
41 0.3
42 0.32
43 0.31
44 0.3
45 0.3
46 0.35
47 0.4
48 0.47
49 0.57
50 0.6
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.61
58 0.57
59 0.55
60 0.5
61 0.44
62 0.4
63 0.34
64 0.31
65 0.3
66 0.29
67 0.32
68 0.39
69 0.44
70 0.49
71 0.59
72 0.64
73 0.7
74 0.7
75 0.66
76 0.6
77 0.53
78 0.52
79 0.52
80 0.53
81 0.54
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57