Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P17123

Protein Details
Accession P17123    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
131-156LNEHKVKMFGKKKKVNPMKLNFKGNLHydrophilic
NLS Segment(s)
PositionSequence
142-142K
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007727  Spo12  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0007127  P:meiosis I  
GO:1904750  P:negative regulation of protein localization to nucleolus  
GO:0031536  P:positive regulation of exit from mitosis  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG sce:YHR152W  -  
Pfam View protein in Pfam  
PF05032  Spo12  
Amino Acid Sequences MSNKASDQSARTASILKTDITRENTITRSSSSNNDNYHHHNNINNYNESAKTGEDANKENIPNLEEEIAAFRIFRKKSTSNLKSSHTTSNLVKKTMFKRDLLKQDPKRKLQLQQRFASPTDRLVSPCSLKLNEHKVKMFGKKKKVNPMKLNFKGNLAADSEDVEIDEDEEYFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.23
4 0.22
5 0.24
6 0.3
7 0.31
8 0.34
9 0.31
10 0.33
11 0.34
12 0.34
13 0.32
14 0.28
15 0.26
16 0.26
17 0.29
18 0.3
19 0.34
20 0.35
21 0.35
22 0.37
23 0.41
24 0.45
25 0.44
26 0.41
27 0.39
28 0.41
29 0.46
30 0.47
31 0.41
32 0.35
33 0.33
34 0.31
35 0.29
36 0.24
37 0.17
38 0.13
39 0.14
40 0.16
41 0.17
42 0.2
43 0.22
44 0.24
45 0.24
46 0.25
47 0.23
48 0.2
49 0.18
50 0.16
51 0.13
52 0.09
53 0.09
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.14
60 0.15
61 0.16
62 0.21
63 0.22
64 0.3
65 0.41
66 0.45
67 0.45
68 0.49
69 0.51
70 0.48
71 0.49
72 0.46
73 0.37
74 0.34
75 0.3
76 0.35
77 0.33
78 0.3
79 0.29
80 0.3
81 0.33
82 0.4
83 0.39
84 0.33
85 0.37
86 0.44
87 0.52
88 0.53
89 0.59
90 0.58
91 0.66
92 0.72
93 0.71
94 0.7
95 0.65
96 0.67
97 0.67
98 0.68
99 0.66
100 0.62
101 0.62
102 0.58
103 0.54
104 0.5
105 0.4
106 0.33
107 0.28
108 0.25
109 0.22
110 0.22
111 0.24
112 0.22
113 0.24
114 0.24
115 0.23
116 0.24
117 0.3
118 0.38
119 0.41
120 0.43
121 0.42
122 0.44
123 0.49
124 0.56
125 0.59
126 0.57
127 0.62
128 0.67
129 0.73
130 0.79
131 0.83
132 0.84
133 0.84
134 0.86
135 0.86
136 0.85
137 0.84
138 0.74
139 0.66
140 0.6
141 0.51
142 0.43
143 0.34
144 0.27
145 0.2
146 0.21
147 0.19
148 0.14
149 0.13
150 0.12
151 0.1
152 0.09
153 0.09