Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q08746

Protein Details
Accession Q08746    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
174-203IDPRTLNRAERKRLVKKNEKQQRRNMKNALHydrophilic
NLS Segment(s)
PositionSequence
102-130EKPLPKAKAMTKWEKFAAKKGIKPKERAG
183-197ERKRLVKKNEKQQRR
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0034399  C:nuclear periphery  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG sce:YOR294W  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLNRAERKRLVKKNEKQQRRNMKNAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.27
5 0.24
6 0.24
7 0.16
8 0.16
9 0.15
10 0.15
11 0.14
12 0.12
13 0.11
14 0.11
15 0.1
16 0.07
17 0.07
18 0.08
19 0.1
20 0.12
21 0.12
22 0.11
23 0.14
24 0.17
25 0.16
26 0.17
27 0.19
28 0.23
29 0.3
30 0.34
31 0.33
32 0.32
33 0.35
34 0.38
35 0.41
36 0.45
37 0.44
38 0.45
39 0.5
40 0.55
41 0.55
42 0.55
43 0.49
44 0.44
45 0.37
46 0.33
47 0.29
48 0.24
49 0.2
50 0.14
51 0.13
52 0.11
53 0.1
54 0.09
55 0.08
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.09
65 0.09
66 0.08
67 0.08
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.09
84 0.11
85 0.12
86 0.13
87 0.17
88 0.21
89 0.21
90 0.28
91 0.35
92 0.37
93 0.38
94 0.42
95 0.42
96 0.46
97 0.51
98 0.53
99 0.47
100 0.46
101 0.47
102 0.47
103 0.44
104 0.42
105 0.46
106 0.4
107 0.43
108 0.49
109 0.56
110 0.55
111 0.59
112 0.61
113 0.61
114 0.59
115 0.58
116 0.51
117 0.46
118 0.44
119 0.44
120 0.36
121 0.27
122 0.24
123 0.21
124 0.21
125 0.16
126 0.13
127 0.08
128 0.09
129 0.09
130 0.1
131 0.12
132 0.13
133 0.18
134 0.26
135 0.36
136 0.43
137 0.52
138 0.52
139 0.56
140 0.57
141 0.6
142 0.54
143 0.45
144 0.4
145 0.33
146 0.33
147 0.3
148 0.26
149 0.19
150 0.2
151 0.19
152 0.16
153 0.17
154 0.16
155 0.17
156 0.22
157 0.22
158 0.24
159 0.27
160 0.27
161 0.25
162 0.26
163 0.24
164 0.25
165 0.25
166 0.26
167 0.33
168 0.41
169 0.49
170 0.56
171 0.65
172 0.69
173 0.78
174 0.83
175 0.84
176 0.84
177 0.87
178 0.89
179 0.9
180 0.89
181 0.9
182 0.91
183 0.89