Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38826

Protein Details
Accession P38826    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
109-133KQFAWTPSPKKNKRSPVKNGGRFTSHydrophilic
NLS Segment(s)
PositionSequence
256-267LKTAKALRKRGR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
IPR016811  ORC6_fun  
Gene Ontology GO:0031261  C:DNA replication preinitiation complex  
GO:0005664  C:nuclear origin of replication recognition complex  
GO:0005656  C:nuclear pre-replicative complex  
GO:0005654  C:nucleoplasm  
GO:0005634  C:nucleus  
GO:0003688  F:DNA replication origin binding  
GO:0006270  P:DNA replication initiation  
GO:0006267  P:pre-replicative complex assembly involved in nuclear cell cycle DNA replication  
GO:0030466  P:silent mating-type cassette heterochromatin formation  
KEGG sce:YHR118C  -  
Pfam View protein in Pfam  
PF05460  ORC6  
CDD cd16075  ORC6_CTD  
cd11583  Orc6_mid  
Amino Acid Sequences MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.23
5 0.28
6 0.31
7 0.32
8 0.34
9 0.35
10 0.36
11 0.38
12 0.44
13 0.44
14 0.45
15 0.49
16 0.46
17 0.45
18 0.47
19 0.46
20 0.42
21 0.39
22 0.32
23 0.31
24 0.31
25 0.29
26 0.25
27 0.24
28 0.22
29 0.24
30 0.25
31 0.2
32 0.21
33 0.21
34 0.26
35 0.3
36 0.31
37 0.29
38 0.32
39 0.37
40 0.36
41 0.36
42 0.34
43 0.3
44 0.27
45 0.26
46 0.21
47 0.16
48 0.15
49 0.18
50 0.22
51 0.26
52 0.27
53 0.29
54 0.35
55 0.38
56 0.43
57 0.42
58 0.35
59 0.38
60 0.42
61 0.42
62 0.37
63 0.36
64 0.31
65 0.28
66 0.27
67 0.2
68 0.19
69 0.17
70 0.17
71 0.22
72 0.23
73 0.26
74 0.28
75 0.29
76 0.33
77 0.39
78 0.4
79 0.4
80 0.48
81 0.52
82 0.6
83 0.66
84 0.6
85 0.55
86 0.54
87 0.47
88 0.41
89 0.35
90 0.32
91 0.25
92 0.26
93 0.28
94 0.29
95 0.28
96 0.26
97 0.26
98 0.25
99 0.32
100 0.37
101 0.4
102 0.47
103 0.57
104 0.64
105 0.7
106 0.73
107 0.75
108 0.79
109 0.83
110 0.84
111 0.84
112 0.87
113 0.87
114 0.82
115 0.75
116 0.67
117 0.58
118 0.54
119 0.53
120 0.44
121 0.41
122 0.38
123 0.38
124 0.43
125 0.48
126 0.44
127 0.38
128 0.38
129 0.34
130 0.38
131 0.36
132 0.35
133 0.35
134 0.38
135 0.38
136 0.42
137 0.43
138 0.45
139 0.54
140 0.58
141 0.59
142 0.6
143 0.57
144 0.52
145 0.5
146 0.43
147 0.37
148 0.26
149 0.19
150 0.15
151 0.14
152 0.13
153 0.14
154 0.17
155 0.15
156 0.18
157 0.19
158 0.2
159 0.2
160 0.22
161 0.29
162 0.25
163 0.28
164 0.27
165 0.28
166 0.28
167 0.31
168 0.32
169 0.26
170 0.29
171 0.27
172 0.27
173 0.24
174 0.22
175 0.18
176 0.15
177 0.12
178 0.08
179 0.07
180 0.06
181 0.05
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.07
188 0.11
189 0.12
190 0.14
191 0.15
192 0.16
193 0.19
194 0.25
195 0.27
196 0.29
197 0.3
198 0.29
199 0.29
200 0.29
201 0.25
202 0.18
203 0.17
204 0.12
205 0.15
206 0.16
207 0.14
208 0.14
209 0.14
210 0.13
211 0.13
212 0.14
213 0.11
214 0.1
215 0.1
216 0.1
217 0.09
218 0.09
219 0.09
220 0.09
221 0.07
222 0.06
223 0.1
224 0.11
225 0.13
226 0.17
227 0.19
228 0.24
229 0.33
230 0.39
231 0.42
232 0.49
233 0.53
234 0.52
235 0.59
236 0.6
237 0.54
238 0.49
239 0.49
240 0.44
241 0.42
242 0.4
243 0.32
244 0.35
245 0.35
246 0.39
247 0.4
248 0.45
249 0.49
250 0.57
251 0.63
252 0.64
253 0.69
254 0.69
255 0.68
256 0.68
257 0.69
258 0.65
259 0.59
260 0.53
261 0.49
262 0.45
263 0.44
264 0.37
265 0.3
266 0.3
267 0.32
268 0.35
269 0.37
270 0.39
271 0.36
272 0.36
273 0.34
274 0.31
275 0.26
276 0.2
277 0.14
278 0.11
279 0.11
280 0.14
281 0.14
282 0.14
283 0.16
284 0.15
285 0.16
286 0.16
287 0.15
288 0.12
289 0.12
290 0.12
291 0.11
292 0.13
293 0.19
294 0.2
295 0.19
296 0.19
297 0.19
298 0.2
299 0.21
300 0.22
301 0.15
302 0.14
303 0.14
304 0.15
305 0.15
306 0.14
307 0.13
308 0.14
309 0.13
310 0.14
311 0.14
312 0.13
313 0.12
314 0.12
315 0.11
316 0.07
317 0.15
318 0.15
319 0.25
320 0.35
321 0.38
322 0.44
323 0.51
324 0.57
325 0.59
326 0.67
327 0.67
328 0.66
329 0.68
330 0.65
331 0.62
332 0.61
333 0.54
334 0.45
335 0.37
336 0.27
337 0.23
338 0.19
339 0.17
340 0.15
341 0.17
342 0.19
343 0.18
344 0.19
345 0.19
346 0.19
347 0.18
348 0.17
349 0.16
350 0.14
351 0.13
352 0.13
353 0.13
354 0.13
355 0.14
356 0.12
357 0.1
358 0.11
359 0.14
360 0.17
361 0.18
362 0.2
363 0.2
364 0.22
365 0.21
366 0.21
367 0.23
368 0.23
369 0.27
370 0.36
371 0.36
372 0.36
373 0.38
374 0.39
375 0.33
376 0.33
377 0.28
378 0.2
379 0.19
380 0.17
381 0.16
382 0.19
383 0.21
384 0.2
385 0.19
386 0.17
387 0.19
388 0.19
389 0.2
390 0.19
391 0.21
392 0.2
393 0.22
394 0.23
395 0.22
396 0.22
397 0.2
398 0.17
399 0.13
400 0.14
401 0.14
402 0.13
403 0.14
404 0.19
405 0.26
406 0.28
407 0.33
408 0.34
409 0.32
410 0.39
411 0.45
412 0.44
413 0.4
414 0.43
415 0.44