Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q12315

Protein Details
Accession Q12315    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-166QSIRENKRRVEEQRKRKEEEBasic
NLS Segment(s)
PositionSequence
152-213NKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012476  GLE1  
IPR038506  GLE1-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005739  C:mitochondrion  
GO:0005635  C:nuclear envelope  
GO:0031965  C:nuclear membrane  
GO:0005643  C:nuclear pore  
GO:0044614  C:nuclear pore cytoplasmic filaments  
GO:0008047  F:enzyme activator activity  
GO:0000822  F:inositol hexakisphosphate binding  
GO:0005543  F:phospholipid binding  
GO:0031369  F:translation initiation factor binding  
GO:0006406  P:mRNA export from nucleus  
GO:0006397  P:mRNA processing  
GO:0006913  P:nucleocytoplasmic transport  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
GO:0015031  P:protein transport  
GO:0006446  P:regulation of translational initiation  
GO:0006449  P:regulation of translational termination  
GO:0006409  P:tRNA export from nucleus  
KEGG sce:YDL207W  -  
Pfam View protein in Pfam  
PF07817  GLE1  
Amino Acid Sequences MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.2
5 0.17
6 0.19
7 0.19
8 0.2
9 0.19
10 0.17
11 0.15
12 0.16
13 0.19
14 0.2
15 0.23
16 0.25
17 0.26
18 0.28
19 0.31
20 0.36
21 0.35
22 0.38
23 0.38
24 0.39
25 0.42
26 0.43
27 0.45
28 0.4
29 0.4
30 0.37
31 0.38
32 0.37
33 0.31
34 0.38
35 0.37
36 0.42
37 0.46
38 0.47
39 0.48
40 0.53
41 0.59
42 0.5
43 0.46
44 0.42
45 0.37
46 0.34
47 0.28
48 0.19
49 0.13
50 0.12
51 0.11
52 0.1
53 0.07
54 0.06
55 0.07
56 0.09
57 0.09
58 0.1
59 0.12
60 0.16
61 0.18
62 0.18
63 0.17
64 0.2
65 0.22
66 0.22
67 0.22
68 0.18
69 0.19
70 0.19
71 0.19
72 0.16
73 0.15
74 0.14
75 0.12
76 0.11
77 0.09
78 0.08
79 0.09
80 0.09
81 0.07
82 0.08
83 0.1
84 0.11
85 0.13
86 0.16
87 0.18
88 0.2
89 0.22
90 0.25
91 0.28
92 0.29
93 0.3
94 0.29
95 0.3
96 0.33
97 0.37
98 0.35
99 0.31
100 0.3
101 0.28
102 0.27
103 0.24
104 0.2
105 0.16
106 0.14
107 0.13
108 0.12
109 0.11
110 0.1
111 0.1
112 0.08
113 0.08
114 0.09
115 0.09
116 0.1
117 0.1
118 0.12
119 0.13
120 0.14
121 0.16
122 0.17
123 0.23
124 0.23
125 0.26
126 0.34
127 0.33
128 0.34
129 0.34
130 0.32
131 0.28
132 0.26
133 0.25
134 0.24
135 0.33
136 0.41
137 0.46
138 0.49
139 0.49
140 0.55
141 0.6
142 0.62
143 0.64
144 0.65
145 0.68
146 0.76
147 0.8
148 0.79
149 0.75
150 0.77
151 0.76
152 0.77
153 0.77
154 0.74
155 0.73
156 0.71
157 0.7
158 0.67
159 0.66
160 0.66
161 0.65
162 0.64
163 0.68
164 0.7
165 0.67
166 0.62
167 0.56
168 0.55
169 0.55
170 0.56
171 0.54
172 0.51
173 0.51
174 0.55
175 0.6
176 0.6
177 0.6
178 0.63
179 0.63
180 0.67
181 0.7
182 0.65
183 0.65
184 0.61
185 0.59
186 0.57
187 0.58
188 0.61
189 0.62
190 0.6
191 0.53
192 0.5
193 0.47
194 0.49
195 0.47
196 0.42
197 0.42
198 0.46
199 0.48
200 0.51
201 0.52
202 0.52
203 0.51
204 0.57
205 0.61
206 0.59
207 0.61
208 0.61
209 0.57
210 0.54
211 0.54
212 0.51
213 0.52
214 0.54
215 0.54
216 0.5
217 0.52
218 0.55
219 0.57
220 0.52
221 0.45
222 0.44
223 0.42
224 0.42
225 0.38
226 0.29
227 0.24
228 0.24
229 0.3
230 0.28
231 0.28
232 0.26
233 0.25
234 0.27
235 0.25
236 0.25
237 0.19
238 0.21
239 0.23
240 0.27
241 0.35
242 0.35
243 0.39
244 0.42
245 0.45
246 0.48
247 0.44
248 0.44
249 0.36
250 0.37
251 0.32
252 0.3
253 0.26
254 0.21
255 0.2
256 0.17
257 0.15
258 0.14
259 0.14
260 0.13
261 0.18
262 0.21
263 0.24
264 0.27
265 0.27
266 0.28
267 0.28
268 0.35
269 0.38
270 0.4
271 0.43
272 0.48
273 0.54
274 0.63
275 0.73
276 0.77
277 0.72
278 0.72
279 0.72
280 0.65
281 0.64
282 0.56
283 0.51
284 0.45
285 0.44
286 0.38
287 0.31
288 0.3
289 0.27
290 0.26
291 0.21
292 0.2
293 0.15
294 0.16
295 0.19
296 0.2
297 0.17
298 0.16
299 0.16
300 0.13
301 0.13
302 0.11
303 0.09
304 0.08
305 0.08
306 0.08
307 0.06
308 0.07
309 0.1
310 0.11
311 0.11
312 0.11
313 0.11
314 0.11
315 0.12
316 0.1
317 0.07
318 0.07
319 0.06
320 0.06
321 0.08
322 0.09
323 0.09
324 0.09
325 0.1
326 0.1
327 0.13
328 0.15
329 0.13
330 0.13
331 0.14
332 0.14
333 0.14
334 0.15
335 0.15
336 0.16
337 0.15
338 0.16
339 0.16
340 0.16
341 0.15
342 0.12
343 0.1
344 0.1
345 0.08
346 0.09
347 0.08
348 0.08
349 0.09
350 0.09
351 0.09
352 0.1
353 0.1
354 0.09
355 0.08
356 0.08
357 0.09
358 0.11
359 0.13
360 0.11
361 0.14
362 0.17
363 0.2
364 0.22
365 0.22
366 0.23
367 0.22
368 0.24
369 0.24
370 0.26
371 0.25
372 0.24
373 0.24
374 0.21
375 0.2
376 0.19
377 0.18
378 0.17
379 0.21
380 0.22
381 0.23
382 0.23
383 0.31
384 0.38
385 0.46
386 0.51
387 0.48
388 0.55
389 0.64
390 0.68
391 0.66
392 0.64
393 0.61
394 0.59
395 0.61
396 0.53
397 0.46
398 0.47
399 0.44
400 0.38
401 0.32
402 0.26
403 0.21
404 0.2
405 0.18
406 0.12
407 0.08
408 0.06
409 0.05
410 0.05
411 0.05
412 0.04
413 0.05
414 0.05
415 0.06
416 0.07
417 0.08
418 0.09
419 0.11
420 0.13
421 0.14
422 0.16
423 0.15
424 0.15
425 0.18
426 0.19
427 0.21
428 0.21
429 0.21
430 0.19
431 0.18
432 0.17
433 0.16
434 0.17
435 0.16
436 0.16
437 0.16
438 0.17
439 0.18
440 0.19
441 0.17
442 0.18
443 0.21
444 0.2
445 0.22
446 0.22
447 0.23
448 0.24
449 0.27
450 0.25
451 0.22
452 0.22
453 0.24
454 0.24
455 0.22
456 0.2
457 0.15
458 0.15
459 0.13
460 0.13
461 0.11
462 0.1
463 0.09
464 0.09
465 0.1
466 0.08
467 0.1
468 0.08
469 0.07
470 0.07
471 0.07
472 0.08
473 0.09
474 0.12
475 0.12
476 0.14
477 0.13
478 0.14
479 0.14
480 0.14
481 0.14
482 0.1
483 0.08
484 0.07
485 0.09
486 0.09
487 0.09
488 0.09
489 0.09
490 0.09
491 0.09
492 0.09
493 0.12
494 0.13
495 0.15
496 0.17
497 0.2
498 0.27
499 0.31
500 0.33
501 0.35
502 0.37
503 0.39
504 0.43
505 0.39
506 0.32
507 0.29
508 0.3
509 0.32
510 0.35
511 0.34
512 0.34
513 0.34
514 0.34
515 0.35
516 0.3
517 0.23
518 0.19