FuNGI

Q12315

Protein Details

Accession

Q12315

Localization Confidence

Medium

Confidence Score

14.4

NoLS Segment(s)

Position	Sequence	Protein Nature
147-166	QSIRENKRRVEEQRKRKEEE	Basic

NLS Segment(s)

Position	Sequence
152-213	NKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKK

Subcellular Location(s)

nucl 23.5, cyto_nucl 13.5

Family & Domain DBs

InterPro	View protein in InterPro IPR012476 GLE1 IPR038506 GLE1-like_sf
Gene Ontology	GO:0005737 C:cytoplasm GO:0005739 C:mitochondrion GO:0005635 C:nuclear envelope GO:0031965 C:nuclear membrane GO:0005643 C:nuclear pore GO:0044614 C:nuclear pore cytoplasmic filaments GO:0008047 F:enzyme activator activity GO:0000822 F:inositol hexakisphosphate binding GO:0005543 F:phospholipid binding GO:0031369 F:translation initiation factor binding GO:0006406 P:mRNA export from nucleus GO:0006397 P:mRNA processing GO:0006913 P:nucleocytoplasmic transport GO:0016973 P:poly(A)+ mRNA export from nucleus GO:0015031 P:protein transport GO:0006446 P:regulation of translational initiation GO:0006449 P:regulation of translational termination GO:0006409 P:tRNA export from nucleus
KEGG	sce:YDL207W -
Pfam	View protein in Pfam PF07817 GLE1

Amino Acid Sequences

MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.18
3	0.2
4	0.2
5	0.17
6	0.19
7	0.19
8	0.2
9	0.19
10	0.17
11	0.15
12	0.16
13	0.19
14	0.2
15	0.23
16	0.25
17	0.26
18	0.28
19	0.31
20	0.36
21	0.35
22	0.38
23	0.38
24	0.39
25	0.42
26	0.43
27	0.45
28	0.4
29	0.4
30	0.37
31	0.38
32	0.37
33	0.31
34	0.38
35	0.37
36	0.42
37	0.46
38	0.47
39	0.48
40	0.53
41	0.59
42	0.5
43	0.46
44	0.42
45	0.37
46	0.34
47	0.28
48	0.19
49	0.13
50	0.12
51	0.11
52	0.1
53	0.07
54	0.06
55	0.07
56	0.09
57	0.09
58	0.1
59	0.12
60	0.16
61	0.18
62	0.18
63	0.17
64	0.2
65	0.22
66	0.22
67	0.22
68	0.18
69	0.19
70	0.19
71	0.19
72	0.16
73	0.15
74	0.14
75	0.12
76	0.11
77	0.09
78	0.08
79	0.09
80	0.09
81	0.07
82	0.08
83	0.1
84	0.11
85	0.13
86	0.16
87	0.18
88	0.2
89	0.22
90	0.25
91	0.28
92	0.29
93	0.3
94	0.29
95	0.3
96	0.33
97	0.37
98	0.35
99	0.31
100	0.3
101	0.28
102	0.27
103	0.24
104	0.2
105	0.16
106	0.14
107	0.13
108	0.12
109	0.11
110	0.1
111	0.1
112	0.08
113	0.08
114	0.09
115	0.09
116	0.1
117	0.1
118	0.12
119	0.13
120	0.14
121	0.16
122	0.17
123	0.23
124	0.23
125	0.26
126	0.34
127	0.33
128	0.34
129	0.34
130	0.32
131	0.28
132	0.26
133	0.25
134	0.24
135	0.33
136	0.41
137	0.46
138	0.49
139	0.49
140	0.55
141	0.6
142	0.62
143	0.64
144	0.65
145	0.68
146	0.76
147	0.8
148	0.79
149	0.75
150	0.77
151	0.76
152	0.77
153	0.77
154	0.74
155	0.73
156	0.71
157	0.7
158	0.67
159	0.66
160	0.66
161	0.65
162	0.64
163	0.68
164	0.7
165	0.67
166	0.62
167	0.56
168	0.55
169	0.55
170	0.56
171	0.54
172	0.51
173	0.51
174	0.55
175	0.6
176	0.6
177	0.6
178	0.63
179	0.63
180	0.67
181	0.7
182	0.65
183	0.65
184	0.61
185	0.59
186	0.57
187	0.58
188	0.61
189	0.62
190	0.6
191	0.53
192	0.5
193	0.47
194	0.49
195	0.47
196	0.42
197	0.42
198	0.46
199	0.48
200	0.51
201	0.52
202	0.52
203	0.51
204	0.57
205	0.61
206	0.59
207	0.61
208	0.61
209	0.57
210	0.54
211	0.54
212	0.51
213	0.52
214	0.54
215	0.54
216	0.5
217	0.52
218	0.55
219	0.57
220	0.52
221	0.45
222	0.44
223	0.42
224	0.42
225	0.38
226	0.29
227	0.24
228	0.24
229	0.3
230	0.28
231	0.28
232	0.26
233	0.25
234	0.27
235	0.25
236	0.25
237	0.19
238	0.21
239	0.23
240	0.27
241	0.35
242	0.35
243	0.39
244	0.42
245	0.45
246	0.48
247	0.44
248	0.44
249	0.36
250	0.37
251	0.32
252	0.3
253	0.26
254	0.21
255	0.2
256	0.17
257	0.15
258	0.14
259	0.14
260	0.13
261	0.18
262	0.21
263	0.24
264	0.27
265	0.27
266	0.28
267	0.28
268	0.35
269	0.38
270	0.4
271	0.43
272	0.48
273	0.54
274	0.63
275	0.73
276	0.77
277	0.72
278	0.72
279	0.72
280	0.65
281	0.64
282	0.56
283	0.51
284	0.45
285	0.44
286	0.38
287	0.31
288	0.3
289	0.27
290	0.26
291	0.21
292	0.2
293	0.15
294	0.16
295	0.19
296	0.2
297	0.17
298	0.16
299	0.16
300	0.13
301	0.13
302	0.11
303	0.09
304	0.08
305	0.08
306	0.08
307	0.06
308	0.07
309	0.1
310	0.11
311	0.11
312	0.11
313	0.11
314	0.11
315	0.12
316	0.1
317	0.07
318	0.07
319	0.06
320	0.06
321	0.08
322	0.09
323	0.09
324	0.09
325	0.1
326	0.1
327	0.13
328	0.15
329	0.13
330	0.13
331	0.14
332	0.14
333	0.14
334	0.15
335	0.15
336	0.16
337	0.15
338	0.16
339	0.16
340	0.16
341	0.15
342	0.12
343	0.1
344	0.1
345	0.08
346	0.09
347	0.08
348	0.08
349	0.09
350	0.09
351	0.09
352	0.1
353	0.1
354	0.09
355	0.08
356	0.08
357	0.09
358	0.11
359	0.13
360	0.11
361	0.14
362	0.17
363	0.2
364	0.22
365	0.22
366	0.23
367	0.22
368	0.24
369	0.24
370	0.26
371	0.25
372	0.24
373	0.24
374	0.21
375	0.2
376	0.19
377	0.18
378	0.17
379	0.21
380	0.22
381	0.23
382	0.23
383	0.31
384	0.38
385	0.46
386	0.51
387	0.48
388	0.55
389	0.64
390	0.68
391	0.66
392	0.64
393	0.61
394	0.59
395	0.61
396	0.53
397	0.46
398	0.47
399	0.44
400	0.38
401	0.32
402	0.26
403	0.21
404	0.2
405	0.18
406	0.12
407	0.08
408	0.06
409	0.05
410	0.05
411	0.05
412	0.04
413	0.05
414	0.05
415	0.06
416	0.07
417	0.08
418	0.09
419	0.11
420	0.13
421	0.14
422	0.16
423	0.15
424	0.15
425	0.18
426	0.19
427	0.21
428	0.21
429	0.21
430	0.19
431	0.18
432	0.17
433	0.16
434	0.17
435	0.16
436	0.16
437	0.16
438	0.17
439	0.18
440	0.19
441	0.17
442	0.18
443	0.21
444	0.2
445	0.22
446	0.22
447	0.23
448	0.24
449	0.27
450	0.25
451	0.22
452	0.22
453	0.24
454	0.24
455	0.22
456	0.2
457	0.15
458	0.15
459	0.13
460	0.13
461	0.11
462	0.1
463	0.09
464	0.09
465	0.1
466	0.08
467	0.1
468	0.08
469	0.07
470	0.07
471	0.07
472	0.08
473	0.09
474	0.12
475	0.12
476	0.14
477	0.13
478	0.14
479	0.14
480	0.14
481	0.14
482	0.1
483	0.08
484	0.07
485	0.09
486	0.09
487	0.09
488	0.09
489	0.09
490	0.09
491	0.09
492	0.09
493	0.12
494	0.13
495	0.15
496	0.17
497	0.2
498	0.27
499	0.31
500	0.33
501	0.35
502	0.37
503	0.39
504	0.43
505	0.39
506	0.32
507	0.29
508	0.3
509	0.32
510	0.35
511	0.34
512	0.34
513	0.34
514	0.34
515	0.35
516	0.3
517	0.23
518	0.19

Q12315

3D AlphaFold-predicted Structure Viewer