Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q3E792

Protein Details
Accession Q3E792   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AALAGGKKSKKKWSKKSMKDRAQHAVHydrophilic
NLS Segment(s)
PositionSequence
11-33AKAAAALAGGKKSKKKWSKKSMK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG sce:YGR027C  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.65
14 0.73
15 0.81
16 0.86
17 0.92
18 0.93
19 0.92
20 0.88
21 0.83
22 0.79
23 0.7
24 0.61
25 0.5
26 0.42
27 0.34
28 0.29
29 0.23
30 0.16
31 0.14
32 0.13
33 0.14
34 0.14
35 0.12
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.17
67 0.17
68 0.17
69 0.17
70 0.18
71 0.17
72 0.21
73 0.23
74 0.22
75 0.21
76 0.23
77 0.23
78 0.32
79 0.41
80 0.38
81 0.43
82 0.45
83 0.52
84 0.54
85 0.61
86 0.58
87 0.54
88 0.56