Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q04598

Protein Details
Accession Q04598   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-105LARAKSKQGSKILKRRKLKGRWFLSHHydrophilic
NLS Segment(s)
PositionSequence
72-100KRKRTFGFLARAKSKQGSKILKRRKLKGR
Subcellular Location(s) mito 20.5, cyto_mito 11.333, nucl 4.5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005743  C:mitochondrial inner membrane  
GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG sce:YDR115W  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.43
4 0.47
5 0.4
6 0.35
7 0.3
8 0.26
9 0.24
10 0.24
11 0.22
12 0.15
13 0.17
14 0.16
15 0.14
16 0.14
17 0.14
18 0.14
19 0.16
20 0.16
21 0.12
22 0.12
23 0.13
24 0.16
25 0.16
26 0.14
27 0.14
28 0.14
29 0.13
30 0.14
31 0.17
32 0.18
33 0.17
34 0.18
35 0.17
36 0.17
37 0.16
38 0.15
39 0.15
40 0.14
41 0.17
42 0.18
43 0.19
44 0.2
45 0.23
46 0.29
47 0.29
48 0.36
49 0.45
50 0.51
51 0.57
52 0.59
53 0.64
54 0.62
55 0.63
56 0.63
57 0.59
58 0.61
59 0.57
60 0.62
61 0.54
62 0.58
63 0.59
64 0.57
65 0.6
66 0.56
67 0.6
68 0.57
69 0.58
70 0.53
71 0.52
72 0.5
73 0.46
74 0.5
75 0.52
76 0.57
77 0.66
78 0.74
79 0.78
80 0.83
81 0.85
82 0.86
83 0.87
84 0.87
85 0.87