Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P53082

Protein Details
Accession P53082    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40LTTQWRETKRQRHYKMPVTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045115  BOL2  
IPR002634  BolA  
IPR036065  BolA-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:1990229  C:iron-sulfur cluster assembly complex  
GO:0005634  C:nucleus  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0051536  F:iron-sulfur cluster binding  
GO:0006879  P:intracellular iron ion homeostasis  
GO:0016226  P:iron-sulfur cluster assembly  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0097428  P:protein maturation by iron-sulfur cluster transfer  
KEGG sce:YGL220W  -  
Pfam View protein in Pfam  
PF01722  BolA  
Amino Acid Sequences MTGERIEKVKINDEFAKSHFLTTQWRETKRQRHYKMPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQGKSKLMRSRAVNKAVKEELQEIHAFSCKCYTEEEWSKIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.42
4 0.34
5 0.33
6 0.28
7 0.24
8 0.28
9 0.31
10 0.39
11 0.4
12 0.43
13 0.49
14 0.57
15 0.66
16 0.68
17 0.74
18 0.7
19 0.73
20 0.78
21 0.8
22 0.79
23 0.75
24 0.71
25 0.66
26 0.66
27 0.58
28 0.55
29 0.48
30 0.4
31 0.34
32 0.29
33 0.23
34 0.19
35 0.16
36 0.13
37 0.14
38 0.13
39 0.13
40 0.12
41 0.12
42 0.11
43 0.11
44 0.09
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.09
67 0.1
68 0.11
69 0.14
70 0.19
71 0.24
72 0.28
73 0.33
74 0.37
75 0.46
76 0.53
77 0.59
78 0.58
79 0.53
80 0.56
81 0.53
82 0.48
83 0.42
84 0.38
85 0.29
86 0.27
87 0.27
88 0.21
89 0.2
90 0.23
91 0.2
92 0.18
93 0.22
94 0.2
95 0.2
96 0.23
97 0.25
98 0.31
99 0.39
100 0.43