Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P47110

Protein Details
Accession P47110   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
321-340SSSKKQETPSSNKRLKKQGTHydrophilic
NLS Segment(s)
PositionSequence
310-350RKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0005634  C:nucleus  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0006284  P:base-excision repair  
GO:0006277  P:DNA amplification  
GO:0006259  P:DNA metabolic process  
GO:0043137  P:DNA replication, removal of RNA primer  
GO:0000727  P:double-strand break repair via break-induced replication  
GO:0006273  P:lagging strand elongation  
GO:0006272  P:leading strand elongation  
GO:0006289  P:nucleotide-excision repair  
GO:0006278  P:RNA-templated DNA biosynthetic process  
KEGG sce:YJR043C  -  
Amino Acid Sequences MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVTKRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.34
4 0.27
5 0.27
6 0.27
7 0.25
8 0.24
9 0.24
10 0.21
11 0.27
12 0.29
13 0.27
14 0.26
15 0.23
16 0.24
17 0.25
18 0.25
19 0.21
20 0.21
21 0.26
22 0.3
23 0.31
24 0.3
25 0.31
26 0.35
27 0.32
28 0.31
29 0.34
30 0.36
31 0.38
32 0.4
33 0.4
34 0.38
35 0.45
36 0.46
37 0.43
38 0.4
39 0.4
40 0.4
41 0.39
42 0.36
43 0.31
44 0.32
45 0.31
46 0.32
47 0.32
48 0.33
49 0.32
50 0.36
51 0.38
52 0.36
53 0.37
54 0.38
55 0.34
56 0.34
57 0.34
58 0.31
59 0.32
60 0.3
61 0.26
62 0.22
63 0.22
64 0.19
65 0.2
66 0.19
67 0.13
68 0.12
69 0.11
70 0.11
71 0.11
72 0.1
73 0.1
74 0.08
75 0.07
76 0.08
77 0.09
78 0.09
79 0.1
80 0.11
81 0.1
82 0.12
83 0.12
84 0.12
85 0.15
86 0.17
87 0.17
88 0.17
89 0.17
90 0.15
91 0.19
92 0.18
93 0.16
94 0.17
95 0.18
96 0.18
97 0.26
98 0.26
99 0.24
100 0.26
101 0.25
102 0.25
103 0.27
104 0.28
105 0.22
106 0.22
107 0.22
108 0.24
109 0.29
110 0.28
111 0.25
112 0.24
113 0.26
114 0.3
115 0.33
116 0.32
117 0.35
118 0.35
119 0.38
120 0.43
121 0.47
122 0.43
123 0.41
124 0.47
125 0.41
126 0.47
127 0.51
128 0.53
129 0.49
130 0.49
131 0.5
132 0.49
133 0.51
134 0.44
135 0.39
136 0.35
137 0.35
138 0.41
139 0.43
140 0.4
141 0.39
142 0.4
143 0.44
144 0.46
145 0.51
146 0.5
147 0.49
148 0.53
149 0.5
150 0.5
151 0.42
152 0.36
153 0.29
154 0.24
155 0.22
156 0.16
157 0.18
158 0.22
159 0.24
160 0.28
161 0.33
162 0.35
163 0.38
164 0.46
165 0.46
166 0.5
167 0.57
168 0.54
169 0.55
170 0.56
171 0.56
172 0.57
173 0.62
174 0.61
175 0.59
176 0.61
177 0.59
178 0.64
179 0.67
180 0.67
181 0.68
182 0.66
183 0.67
184 0.69
185 0.7
186 0.69
187 0.63
188 0.58
189 0.51
190 0.48
191 0.46
192 0.43
193 0.4
194 0.35
195 0.38
196 0.34
197 0.33
198 0.31
199 0.27
200 0.23
201 0.21
202 0.17
203 0.11
204 0.1
205 0.08
206 0.06
207 0.07
208 0.07
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.06
215 0.05
216 0.06
217 0.11
218 0.14
219 0.19
220 0.22
221 0.24
222 0.27
223 0.33
224 0.4
225 0.44
226 0.46
227 0.5
228 0.53
229 0.53
230 0.52
231 0.48
232 0.46
233 0.4
234 0.34
235 0.27
236 0.21
237 0.2
238 0.19
239 0.16
240 0.11
241 0.09
242 0.08
243 0.07
244 0.06
245 0.05
246 0.04
247 0.04
248 0.07
249 0.09
250 0.09
251 0.09
252 0.1
253 0.15
254 0.17
255 0.17
256 0.21
257 0.25
258 0.33
259 0.37
260 0.41
261 0.44
262 0.46
263 0.49
264 0.51
265 0.54
266 0.48
267 0.46
268 0.44
269 0.43
270 0.44
271 0.47
272 0.43
273 0.38
274 0.38
275 0.37
276 0.4
277 0.33
278 0.28
279 0.22
280 0.18
281 0.15
282 0.14
283 0.14
284 0.09
285 0.1
286 0.12
287 0.14
288 0.14
289 0.17
290 0.18
291 0.24
292 0.35
293 0.45
294 0.54
295 0.6
296 0.63
297 0.65
298 0.68
299 0.71
300 0.71
301 0.7
302 0.67
303 0.62
304 0.63
305 0.65
306 0.69
307 0.64
308 0.61
309 0.62
310 0.64
311 0.65
312 0.64
313 0.66
314 0.65
315 0.7
316 0.72
317 0.72
318 0.72
319 0.74
320 0.79
321 0.81
322 0.79
323 0.78
324 0.77
325 0.76
326 0.78
327 0.77
328 0.76
329 0.74
330 0.74