Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P40503

Protein Details
Accession P40503    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-99ITFFCPRYFKKRPLGRHAKGKGKSDEHydrophilic
NLS Segment(s)
PositionSequence
83-97KKRPLGRHAKGKGKS
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MNKIIKESTNFSRYLRTGGVLNSLRTTSKFVYINNNSYLTHGGFDGNVATIFNISEFNYINSSAKGSLLTYKSITFFCPRYFKKRPLGRHAKGKGKSDEKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.26
4 0.24
5 0.23
6 0.3
7 0.25
8 0.26
9 0.23
10 0.23
11 0.22
12 0.21
13 0.25
14 0.18
15 0.21
16 0.22
17 0.22
18 0.31
19 0.35
20 0.38
21 0.36
22 0.36
23 0.31
24 0.3
25 0.3
26 0.2
27 0.16
28 0.12
29 0.1
30 0.08
31 0.08
32 0.07
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.1
48 0.09
49 0.1
50 0.09
51 0.09
52 0.08
53 0.08
54 0.12
55 0.13
56 0.15
57 0.15
58 0.16
59 0.17
60 0.17
61 0.19
62 0.18
63 0.2
64 0.23
65 0.31
66 0.35
67 0.43
68 0.5
69 0.56
70 0.62
71 0.68
72 0.72
73 0.74
74 0.81
75 0.8
76 0.83
77 0.84
78 0.83
79 0.81
80 0.8
81 0.79
82 0.75