Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P38784

Protein Details
Accession P38784   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
103-130EDNKLTQRKKGTKPEKQKTQSHKLKQDYHydrophilic
NLS Segment(s)
PositionSequence
109-118QRKKGTKPEK
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0005634  C:nucleus  
GO:1990871  C:Vma12-Vma22 assembly complex  
GO:0051082  F:unfolded protein binding  
GO:0007035  P:vacuolar acidification  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG sce:YHR060W  -  
Amino Acid Sequences MSETRMAQNMDTTDEQYLRLIELLSNYDSTLEQLQKGFQDGYIQLSRSNYYNKDSLRGNYGEDYWDETYIGQLMATVEEKNSKVVVEIVKRKAQDKQEKKEEEDNKLTQRKKGTKPEKQKTQSHKLKQDYDPILMFGGVLSVPSSLRQSQTSFKGCIPLIAQLINYKNEILTLVETLSEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.18
5 0.14
6 0.13
7 0.12
8 0.09
9 0.11
10 0.13
11 0.13
12 0.13
13 0.12
14 0.13
15 0.12
16 0.13
17 0.16
18 0.15
19 0.15
20 0.15
21 0.17
22 0.16
23 0.18
24 0.17
25 0.12
26 0.15
27 0.14
28 0.19
29 0.2
30 0.2
31 0.19
32 0.2
33 0.21
34 0.2
35 0.24
36 0.2
37 0.22
38 0.26
39 0.25
40 0.28
41 0.29
42 0.28
43 0.29
44 0.28
45 0.26
46 0.22
47 0.22
48 0.19
49 0.17
50 0.2
51 0.15
52 0.14
53 0.13
54 0.11
55 0.11
56 0.1
57 0.1
58 0.05
59 0.05
60 0.04
61 0.05
62 0.06
63 0.06
64 0.05
65 0.08
66 0.08
67 0.09
68 0.09
69 0.08
70 0.07
71 0.1
72 0.13
73 0.17
74 0.23
75 0.26
76 0.28
77 0.29
78 0.3
79 0.33
80 0.39
81 0.44
82 0.47
83 0.52
84 0.59
85 0.61
86 0.64
87 0.67
88 0.63
89 0.59
90 0.56
91 0.51
92 0.49
93 0.53
94 0.51
95 0.46
96 0.5
97 0.52
98 0.54
99 0.61
100 0.64
101 0.67
102 0.77
103 0.83
104 0.85
105 0.84
106 0.85
107 0.83
108 0.84
109 0.83
110 0.81
111 0.8
112 0.76
113 0.77
114 0.71
115 0.71
116 0.63
117 0.56
118 0.48
119 0.39
120 0.32
121 0.24
122 0.21
123 0.11
124 0.08
125 0.05
126 0.05
127 0.04
128 0.04
129 0.05
130 0.06
131 0.09
132 0.1
133 0.13
134 0.15
135 0.18
136 0.24
137 0.31
138 0.35
139 0.34
140 0.34
141 0.37
142 0.35
143 0.34
144 0.3
145 0.26
146 0.23
147 0.22
148 0.22
149 0.22
150 0.25
151 0.24
152 0.24
153 0.2
154 0.18
155 0.17
156 0.17
157 0.14
158 0.12
159 0.11
160 0.11
161 0.11