Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P37263

Protein Details
Accession P37263    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-88KYQKALYKGNKKQKQKQQQKQQQKQHQHQPVAHydrophilic
NLS Segment(s)
PositionSequence
95-103EKPVIKKAE
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, mito_nucl 11.166, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0006364  P:rRNA processing  
KEGG sce:YCR087C-A  -  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCSKTFEDGVSYKNHTSCISEDEKYQKALYKGNKKQKQKQQQKQQQKQHQHQPVATPAKKVEKPVIKKAEKVEKTSNGIELHKGKSLYKILKTMKDKGAKKTFLKSLVVDSEGQIRYAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.52
4 0.56
5 0.63
6 0.67
7 0.65
8 0.73
9 0.76
10 0.75
11 0.73
12 0.66
13 0.63
14 0.57
15 0.53
16 0.46
17 0.4
18 0.39
19 0.35
20 0.35
21 0.29
22 0.31
23 0.3
24 0.27
25 0.24
26 0.2
27 0.2
28 0.19
29 0.21
30 0.2
31 0.2
32 0.2
33 0.21
34 0.22
35 0.19
36 0.2
37 0.19
38 0.21
39 0.21
40 0.2
41 0.23
42 0.26
43 0.27
44 0.26
45 0.26
46 0.24
47 0.22
48 0.27
49 0.33
50 0.39
51 0.46
52 0.56
53 0.63
54 0.68
55 0.76
56 0.8
57 0.83
58 0.83
59 0.84
60 0.85
61 0.87
62 0.9
63 0.9
64 0.9
65 0.88
66 0.87
67 0.84
68 0.83
69 0.8
70 0.72
71 0.63
72 0.56
73 0.55
74 0.54
75 0.47
76 0.39
77 0.34
78 0.38
79 0.38
80 0.38
81 0.38
82 0.37
83 0.42
84 0.5
85 0.58
86 0.52
87 0.55
88 0.6
89 0.62
90 0.57
91 0.57
92 0.55
93 0.5
94 0.52
95 0.5
96 0.47
97 0.39
98 0.36
99 0.36
100 0.32
101 0.29
102 0.28
103 0.28
104 0.25
105 0.28
106 0.34
107 0.35
108 0.35
109 0.41
110 0.43
111 0.51
112 0.56
113 0.57
114 0.59
115 0.62
116 0.63
117 0.65
118 0.69
119 0.68
120 0.67
121 0.68
122 0.66
123 0.61
124 0.6
125 0.51
126 0.47
127 0.44
128 0.41
129 0.34
130 0.29
131 0.32
132 0.29
133 0.28