Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CT77

Protein Details
Accession Q6CT77    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-117ATNENLKKRKQREKLLAKVKKDHydrophilic
NLS Segment(s)
PositionSequence
102-114KKRKQREKLLAKV
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG kla:KLLA0_C14784g  -  
Amino Acid Sequences MMTEDDIYQLIVKNLATYDSLLEQLQASFEEGYHQLSRANYHNKNTLRGSYGKDYWDETYTGNRYISINDKHSVSETEEPLHIANDEEIIPEKDEATNENLKKRKQREKLLAKVKKDPIYMFGGALSIPSSLKQCQLSFKASMPVLYQLLELRRTLNGLLDALGTLSNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.12
6 0.11
7 0.13
8 0.12
9 0.12
10 0.11
11 0.1
12 0.1
13 0.09
14 0.09
15 0.08
16 0.08
17 0.1
18 0.1
19 0.14
20 0.14
21 0.14
22 0.15
23 0.16
24 0.19
25 0.24
26 0.33
27 0.33
28 0.37
29 0.45
30 0.44
31 0.49
32 0.49
33 0.44
34 0.38
35 0.37
36 0.38
37 0.35
38 0.35
39 0.31
40 0.3
41 0.29
42 0.27
43 0.26
44 0.22
45 0.17
46 0.2
47 0.21
48 0.21
49 0.19
50 0.18
51 0.17
52 0.17
53 0.23
54 0.21
55 0.22
56 0.22
57 0.22
58 0.22
59 0.23
60 0.22
61 0.19
62 0.19
63 0.17
64 0.17
65 0.16
66 0.16
67 0.15
68 0.14
69 0.1
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.11
84 0.18
85 0.19
86 0.26
87 0.3
88 0.34
89 0.42
90 0.49
91 0.56
92 0.58
93 0.66
94 0.7
95 0.76
96 0.82
97 0.85
98 0.83
99 0.76
100 0.76
101 0.73
102 0.67
103 0.59
104 0.5
105 0.43
106 0.41
107 0.38
108 0.29
109 0.22
110 0.17
111 0.15
112 0.14
113 0.11
114 0.06
115 0.05
116 0.06
117 0.09
118 0.09
119 0.13
120 0.17
121 0.18
122 0.24
123 0.28
124 0.31
125 0.31
126 0.32
127 0.34
128 0.31
129 0.31
130 0.25
131 0.25
132 0.22
133 0.2
134 0.19
135 0.16
136 0.19
137 0.2
138 0.18
139 0.17
140 0.17
141 0.18
142 0.17
143 0.17
144 0.16
145 0.14
146 0.14
147 0.13
148 0.12
149 0.11
150 0.11